Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_009_D01 (175 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P52814|RL39_CAEEL 60S ribosomal protein L39 83 2e-16 sp|Q962S4|RL39_SPOFR 60S ribosomal protein L39 >gi|54036254... 81 8e-16 sp|P51424|RL39_ARATH 60S ribosomal protein L39 78 7e-15 sp|P51425|RL39_MAIZE 60S ribosomal protein L39 >gi|55977802... 77 9e-15 sp|O16130|RL39_DROME 60S ribosomal protein L39 (Ribosomal p... 77 1e-14 sp|Q90YS9|RL39_ICTPU 60S ribosomal protein L39 75 5e-14 sp|P62893|RL39_RAT 60S ribosomal protein L39 >gi|51702813|s... 75 5e-14 sp|Q98TF5|RL39_CHICK 60S ribosomal protein L39 75 5e-14 sp|Q6BHV8|RL39_DEBHA 60S ribosomal protein L39 75 6e-14 sp|P48536|RL39_KLUMA 60S ribosomal protein L39 (L46) 74 1e-13
>sp|P52814|RL39_CAEEL 60S ribosomal protein L39 Length = 51 Score = 82.8 bits (203), Expect = 2e-16 Identities = 35/42 (83%), Positives = 41/42 (97%) Frame = +1 Query: 7 IKKKLAKKQRQNRPIPQWVRLKTGNTIKYNAKTRHWRKTKLK 132 IK+KLAKKQ+QNRP+PQWVR+KTGNT+KYNAK RHWR+TKLK Sbjct: 9 IKRKLAKKQKQNRPMPQWVRMKTGNTMKYNAKRRHWRRTKLK 50
>sp|Q962S4|RL39_SPOFR 60S ribosomal protein L39 sp|Q6F482|RL39_PLUXY 60S ribosomal protein L39 Length = 51 Score = 80.9 bits (198), Expect = 8e-16 Identities = 34/43 (79%), Positives = 41/43 (95%) Frame = +1 Query: 4 LIKKKLAKKQRQNRPIPQWVRLKTGNTIKYNAKTRHWRKTKLK 132 +IK+KLAKK +QNRPIPQWVR++TGNTI+YNAK RHWR+TKLK Sbjct: 8 IIKRKLAKKLKQNRPIPQWVRMRTGNTIRYNAKRRHWRRTKLK 50
>sp|P51424|RL39_ARATH 60S ribosomal protein L39 Length = 51 Score = 77.8 bits (190), Expect = 7e-15 Identities = 33/44 (75%), Positives = 38/44 (86%) Frame = +1 Query: 4 LIKKKLAKKQRQNRPIPQWVRLKTGNTIKYNAKTRHWRKTKLKF 135 +IKKKL KK RQNRPIP W+RL+T NTI+YNAK RHWR+TKL F Sbjct: 8 MIKKKLGKKMRQNRPIPHWIRLRTDNTIRYNAKRRHWRRTKLGF 51
>sp|P51425|RL39_MAIZE 60S ribosomal protein L39 sp|P51426|RL39_ORYSA 60S ribosomal protein L39 Length = 51 Score = 77.4 bits (189), Expect = 9e-15 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = +1 Query: 7 IKKKLAKKQRQNRPIPQWVRLKTGNTIKYNAKTRHWRKTKLKF 135 IKKKLAKK RQNRPIP W+R++T NTI+YNAK RHWR+TKL F Sbjct: 9 IKKKLAKKMRQNRPIPYWIRMRTDNTIRYNAKRRHWRRTKLGF 51
>sp|O16130|RL39_DROME 60S ribosomal protein L39 (Ribosomal protein 46) Length = 51 Score = 77.0 bits (188), Expect = 1e-14 Identities = 33/42 (78%), Positives = 39/42 (92%) Frame = +1 Query: 7 IKKKLAKKQRQNRPIPQWVRLKTGNTIKYNAKTRHWRKTKLK 132 IK+KLAKK +QNR +PQWVRL+TGNTI+YNAK RHWR+TKLK Sbjct: 9 IKQKLAKKLKQNRSVPQWVRLRTGNTIRYNAKRRHWRRTKLK 50
>sp|Q90YS9|RL39_ICTPU 60S ribosomal protein L39 Length = 51 Score = 75.1 bits (183), Expect = 5e-14 Identities = 31/41 (75%), Positives = 38/41 (92%) Frame = +1 Query: 7 IKKKLAKKQRQNRPIPQWVRLKTGNTIKYNAKTRHWRKTKL 129 IK+ LAKKQ+QNRPIPQW+R+KTGN I+YN+K RHWR+TKL Sbjct: 9 IKRFLAKKQKQNRPIPQWIRMKTGNKIRYNSKRRHWRRTKL 49
>sp|P62893|RL39_RAT 60S ribosomal protein L39 sp|P62892|RL39_MOUSE 60S ribosomal protein L39 sp|P62891|RL39_HUMAN 60S ribosomal protein L39 Length = 51 Score = 75.1 bits (183), Expect = 5e-14 Identities = 31/41 (75%), Positives = 38/41 (92%) Frame = +1 Query: 7 IKKKLAKKQRQNRPIPQWVRLKTGNTIKYNAKTRHWRKTKL 129 IK+ LAKKQ+QNRPIPQW+R+KTGN I+YN+K RHWR+TKL Sbjct: 9 IKRFLAKKQKQNRPIPQWIRMKTGNKIRYNSKRRHWRRTKL 49
>sp|Q98TF5|RL39_CHICK 60S ribosomal protein L39 Length = 51 Score = 75.1 bits (183), Expect = 5e-14 Identities = 31/41 (75%), Positives = 38/41 (92%) Frame = +1 Query: 7 IKKKLAKKQRQNRPIPQWVRLKTGNTIKYNAKTRHWRKTKL 129 IK+ LAKKQ+QNRPIPQW+R+KTGN I+YN+K RHWR+TKL Sbjct: 9 IKRFLAKKQKQNRPIPQWIRMKTGNKIRYNSKRRHWRRTKL 49
>sp|Q6BHV8|RL39_DEBHA 60S ribosomal protein L39 Length = 51 Score = 74.7 bits (182), Expect = 6e-14 Identities = 30/40 (75%), Positives = 38/40 (95%) Frame = +1 Query: 10 KKKLAKKQRQNRPIPQWVRLKTGNTIKYNAKTRHWRKTKL 129 K+KLAK Q+QNRP+PQW+RL++GNTI+YNAK RHWR+TKL Sbjct: 10 KQKLAKAQKQNRPLPQWIRLRSGNTIRYNAKRRHWRRTKL 49
>sp|P48536|RL39_KLUMA 60S ribosomal protein L39 (L46) Length = 51 Score = 73.6 bits (179), Expect = 1e-13 Identities = 31/42 (73%), Positives = 37/42 (88%) Frame = +1 Query: 4 LIKKKLAKKQRQNRPIPQWVRLKTGNTIKYNAKTRHWRKTKL 129 +IK+KLAK + QNRP+PQW RLKT NTI+YNAK RHWR+TKL Sbjct: 8 IIKQKLAKAKNQNRPLPQWFRLKTNNTIRYNAKRRHWRRTKL 49
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,585,798 Number of Sequences: 369166 Number of extensions: 248414 Number of successful extensions: 739 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 735 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 739 length of database: 68,354,980 effective HSP length: 30 effective length of database: 62,812,930 effective search space used: 1695949110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)