Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_009_A19 (599 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q35905|RMAR_SACDO Mitochondrial ribosomal protein VAR1 33 0.72 sp|P46213|SYI_THEMA Isoleucyl-tRNA synthetase (Isoleucine--... 32 1.6 sp|Q03208|YML9_YEAST Hypothetical 40.1 kDa protein in NDI1-... 30 3.6 sp|P02381|RMAR_YEAST Mitochondrial ribosomal protein VAR1 30 3.6 sp|P51842|GUC2F_RAT Retinal guanylyl cyclase 2 precursor (G... 30 6.1 sp|O14265|VATH_SCHPO Vacuolar ATP synthase subunit H (V-ATP... 29 7.9 sp|P10845|BXA1_CLOBO Botulinum neurotoxin type A precursor ... 29 7.9
>sp|Q35905|RMAR_SACDO Mitochondrial ribosomal protein VAR1 Length = 373 Score = 32.7 bits (73), Expect = 0.72 Identities = 21/78 (26%), Positives = 33/78 (42%) Frame = -2 Query: 598 MPSLID*R**ININVLNNETKADNNQYSKTIKTFIHRNINFYNNETKLSNYNSCITRLKS 419 MP L D I++N +NN +NN+Y+ I + N N NN +NY I + + Sbjct: 225 MPKLNDHN--ISMNYINNINNINNNKYNNMINLLNNNNNNNNNNNNNNNNYIDNINNIYN 282 Query: 418 YTVFSRIGLKFSFENILI 365 I + L+ Sbjct: 283 NMTIDNIPMDILMYKYLV 300
>sp|P46213|SYI_THEMA Isoleucyl-tRNA synthetase (Isoleucine--tRNA ligase) (IleRS) Length = 919 Score = 31.6 bits (70), Expect = 1.6 Identities = 21/74 (28%), Positives = 39/74 (52%) Frame = +3 Query: 249 NKNLIHENLYLLSIEQVIVHYCKSCRYQDIWSHHLNAIRINIFSNENFKPILENTV*LFN 428 ++ L+ + LLSI + ++ + R QD+ H L+A + + N+ K +LE + Sbjct: 794 DRKLMEDFEKLLSIREDVLKALEEKRQQDVIGHSLDAEVVLVPKNDTIKALLEK----YR 849 Query: 429 RVMHEL*LDSFVSL 470 ++ EL + S VSL Sbjct: 850 DILEELFIVSKVSL 863
>sp|Q03208|YML9_YEAST Hypothetical 40.1 kDa protein in NDI1-ATR1 intergenic region Length = 357 Score = 30.4 bits (67), Expect = 3.6 Identities = 20/56 (35%), Positives = 34/56 (60%), Gaps = 3/56 (5%) Frame = +1 Query: 280 SYRLSKSLYIIVNRVDIKISGLIISMQFESIYSQMKTLNLSL--KTQCS-SLIELC 438 +Y+L ++ ++ + KI L+IS++FE Y ++ + LS KT+ S SL ELC Sbjct: 198 TYKLPSPVHETIDDISKKIIILLISLKFEKNYHFLQPIQLSTNSKTRISKSLDELC 253
>sp|P02381|RMAR_YEAST Mitochondrial ribosomal protein VAR1 Length = 404 Score = 30.4 bits (67), Expect = 3.6 Identities = 18/53 (33%), Positives = 28/53 (52%) Frame = -2 Query: 598 MPSLID*R**ININVLNNETKADNNQYSKTIKTFIHRNINFYNNETKLSNYNS 440 MP L D I++N +NN +NN+Y+ I + N N NN ++N N+ Sbjct: 248 MPKLNDHN--ISMNYINNINNINNNKYNNMINLLNNNNNN--NNNNNINNNNN 296
>sp|P51842|GUC2F_RAT Retinal guanylyl cyclase 2 precursor (Guanylate cyclase 2F, retinal) (RETGC-2) (Rod outer segment membrane guanylate cyclase 2) (ROS-GC2) (Guanylate cyclase F) (GC-F) Length = 1108 Score = 29.6 bits (65), Expect = 6.1 Identities = 12/35 (34%), Positives = 22/35 (62%) Frame = -1 Query: 446 QFMHNSIKELHCVFKDRFKVFI*EYIDSNCIEMMR 342 +F+H +K +CV RF + + +Y +N +EM+R Sbjct: 665 EFIHGRLKSRNCVVDGRFVLKVTDYGFNNILEMLR 699
>sp|O14265|VATH_SCHPO Vacuolar ATP synthase subunit H (V-ATPase H subunit) (Vacuolar proton pump H subunit) (V-ATPase 54 kDa subunit) Length = 450 Score = 29.3 bits (64), Expect = 7.9 Identities = 16/52 (30%), Positives = 29/52 (55%) Frame = +3 Query: 216 LIYVRQ*LYDDNKNLIHENLYLLSIEQVIVHYCKSCRYQDIWSHHLNAIRIN 371 L ++ L + +K+L ++Y ++ I+H+ S R +D W H NA R+N Sbjct: 314 LDFITSTLDESSKHLSTFDMYKSELDTGILHWSPSHRSEDFW--HQNAKRLN 363
>sp|P10845|BXA1_CLOBO Botulinum neurotoxin type A precursor (BoNT/A) (Bontoxilysin A) (BOTOX) [Contains: Botulinum neurotoxin A light-chain; Botulinum neurotoxin A heavy-chain] Length = 1296 Score = 29.3 bits (64), Expect = 7.9 Identities = 24/68 (35%), Positives = 36/68 (52%), Gaps = 5/68 (7%) Frame = +3 Query: 240 YDDNKNLIHENLYLLSIEQVIVHYCKSCRYQDIWSHHL-----NAIRINIFSNENFKPIL 404 Y DN+ L+ + + I+ +I + RY+ S+HL A +INI S NF PI Sbjct: 856 YVDNQRLL--STFTEYIKNIINTSILNLRYE---SNHLIDLSRYASKINIGSKVNFDPID 910 Query: 405 ENTV*LFN 428 +N + LFN Sbjct: 911 KNQIQLFN 918
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,631,121 Number of Sequences: 369166 Number of extensions: 1142579 Number of successful extensions: 2808 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2633 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2784 length of database: 68,354,980 effective HSP length: 105 effective length of database: 48,957,805 effective search space used: 4602033670 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)