Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_008_N22-1 (376 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P38781|RSC30_YEAST Chromatin structure remodeling comple... 29 3.8 sp|Q14738|2A5D_HUMAN Serine/threonine protein phosphatase 2... 28 5.0 sp|P32030|SLP1_DROME Fork head domain transcription factor ... 28 5.0 sp|Q28653|2A5D_RABIT Serine/threonine protein phosphatase 2... 28 5.0 sp|P42918|CRTC2_BOVIN Calreticulin, brain isoform 2 precurs... 28 8.5
>sp|P38781|RSC30_YEAST Chromatin structure remodeling complex protein RSC30 (Remodel the structure of chromatin complex subunit RSC30) Length = 883 Score = 28.9 bits (63), Expect = 3.8 Identities = 14/42 (33%), Positives = 22/42 (52%), Gaps = 5/42 (11%) Frame = +2 Query: 41 HYFHQNFLCLHHHIQFQFYRFLYNLPHKNL-----PNHILHQ 151 + F +NF+ H F+FY L+++ H N PN+ HQ Sbjct: 304 YLFTKNFIIFRDHYLFKFYNILHDICHINQFKVSPPNNKNHQ 345
>sp|Q14738|2A5D_HUMAN Serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, delta isoform (PP2A, B subunit, B' delta isoform) (PP2A, B subunit, B56 delta isoform) (PP2A, B subunit, PR61 delta isoform) (PP2A, B subunit, R5 delta isoform) Length = 602 Score = 28.5 bits (62), Expect = 5.0 Identities = 15/39 (38%), Positives = 20/39 (51%), Gaps = 4/39 (10%) Frame = +2 Query: 23 FSANIIHYFHQNFLCLHHHIQFQ----FYRFLYNLPHKN 127 F I+H + FL L +I+ Q FYRF+Y H N Sbjct: 257 FLKTILHRIYGKFLGLRAYIRRQINHIFYRFIYETEHHN 295
>sp|P32030|SLP1_DROME Fork head domain transcription factor slp1 (Sloppy paired locus protein 1) Length = 322 Score = 28.5 bits (62), Expect = 5.0 Identities = 10/21 (47%), Positives = 16/21 (76%) Frame = -3 Query: 101 NDKIGIEYDDEDKESFDENNE 39 NDK+ +E+DDE ++ DE+ E Sbjct: 80 NDKLDVEFDDELEDQLDEDQE 100
>sp|Q28653|2A5D_RABIT Serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, delta isoform (PP2A, B subunit, B' delta isoform) (PP2A, B subunit, B56 delta isoform) (PP2A, B subunit, PR61 delta isoform) (PP2A, B subunit, R5 delta isoform) (PP2A, B subunit, B'-gamma) Length = 586 Score = 28.5 bits (62), Expect = 5.0 Identities = 15/39 (38%), Positives = 20/39 (51%), Gaps = 4/39 (10%) Frame = +2 Query: 23 FSANIIHYFHQNFLCLHHHIQFQ----FYRFLYNLPHKN 127 F I+H + FL L +I+ Q FYRF+Y H N Sbjct: 241 FLKTILHRIYGKFLGLRAYIRRQINHIFYRFIYETEHHN 279
>sp|P42918|CRTC2_BOVIN Calreticulin, brain isoform 2 precursor (CRP55) (Calregulin) (HACBP) Length = 421 Score = 27.7 bits (60), Expect = 8.5 Identities = 10/29 (34%), Positives = 18/29 (62%) Frame = +2 Query: 2 NHFILILFSANIIHYFHQNFLCLHHHIQF 88 NHF+L L + ++ + ++CLHH + F Sbjct: 4 NHFLLSLVLSIVLLFHFVFYICLHHIVTF 32
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 19,119,237 Number of Sequences: 369166 Number of extensions: 193066 Number of successful extensions: 854 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 841 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 854 length of database: 68,354,980 effective HSP length: 91 effective length of database: 51,544,095 effective search space used: 1700955135 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)