Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_008_M06 (196 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q99MR6|ARS2_MOUSE Arsenite-resistance protein 2 30 1.3 sp|Q9BXP5|ARS2_HUMAN Arsenite-resistance protein 2 30 1.3 sp|Q89AT4|NUON_BUCBP NADH-quinone oxidoreductase chain N (N... 29 3.0 sp|P43512|CHA2_LYMDI Chorion class A proteins Ld2/Ld41 prec... 28 8.7
>sp|Q99MR6|ARS2_MOUSE Arsenite-resistance protein 2 Length = 875 Score = 30.4 bits (67), Expect = 1.3 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +1 Query: 34 YGVHGVQVIPVIPAGYPMAPHASYGPGYDSY 126 YG V+ P +P G P PHA YG G +Y Sbjct: 807 YGAGAVR--PAVPTGGPPYPHAPYGAGRGNY 835
>sp|Q9BXP5|ARS2_HUMAN Arsenite-resistance protein 2 Length = 876 Score = 30.4 bits (67), Expect = 1.3 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +1 Query: 34 YGVHGVQVIPVIPAGYPMAPHASYGPGYDSY 126 YG V+ P +P G P PHA YG G +Y Sbjct: 808 YGAGAVR--PAVPTGGPPYPHAPYGAGRGNY 836
>sp|Q89AT4|NUON_BUCBP NADH-quinone oxidoreductase chain N (NADH dehydrogenase I, chain N) (NDH-1, chain N) Length = 494 Score = 29.3 bits (64), Expect = 3.0 Identities = 15/49 (30%), Positives = 25/49 (51%), Gaps = 2/49 (4%) Frame = -2 Query: 147 FSLINFTIAIITGTIACMGCHWITGWNYRYNLHSMH--TVHTVTSCMSI 7 +SL+ I II+ +AC+ H+ + NY YN + + C+SI Sbjct: 72 YSLLYIGIVIISSFLACIFSHYCSLTNYLYNFEEFYLLLLFCTIGCVSI 120
>sp|P43512|CHA2_LYMDI Chorion class A proteins Ld2/Ld41 precursor Length = 140 Score = 27.7 bits (60), Expect = 8.7 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +1 Query: 10 GHAAGHGMYGVHGVQVIPVIPAGYPMAPHASYGPGYDSYGEV 135 G G+G+ +G+ + A Y A +A YG G D+YG + Sbjct: 34 GIIGGYGLGAPYGLGCGYGLEAPYGWAGYADYGYGLDAYGGI 75
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 22,967,806 Number of Sequences: 369166 Number of extensions: 419345 Number of successful extensions: 1396 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1334 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1395 length of database: 68,354,980 effective HSP length: 36 effective length of database: 61,704,520 effective search space used: 1727726560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)