Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_008_D11 (296 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P42107|YXAH_BACSU Hypothetical protein yxaH 30 1.7 sp|O15027|K0310_HUMAN Protein KIAA0310 29 2.9
>sp|P42107|YXAH_BACSU Hypothetical protein yxaH Length = 402 Score = 30.0 bits (66), Expect = 1.7 Identities = 16/38 (42%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = -1 Query: 212 SLSQMKKNPIQYFF-SVNQFSMRLLFSVQTMEEKLHEP 102 S ++ NP+ YFF S+ FSM LL + LHEP Sbjct: 214 SNGMLRINPLNYFFASIPYFSMFLLGAAAAKSRYLHEP 251
>sp|O15027|K0310_HUMAN Protein KIAA0310 Length = 2179 Score = 29.3 bits (64), Expect = 2.9 Identities = 15/37 (40%), Positives = 23/37 (62%) Frame = +2 Query: 2 NNADVVLADEVSIDEQKANVLWYFLMILELFQGTVRG 112 N A L +E ID++ A++LW F+++L GTV G Sbjct: 1339 NKAMKCLQNENLIDKESASLLWNFIVLLCRQNGTVVG 1375
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,762,737 Number of Sequences: 369166 Number of extensions: 502230 Number of successful extensions: 1292 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1277 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1292 length of database: 68,354,980 effective HSP length: 68 effective length of database: 55,793,000 effective search space used: 1673790000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)