Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_008_A12 (321 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q58667|LEUD1_METJA 3-isopropylmalate dehydratase small s... 32 0.59 sp|O33102|DNLJ_MYCLE DNA ligase (Polydeoxyribonucleotide sy... 28 8.5 sp|Q8EM53|PYRG_OCEIH CTP synthase (UTP--ammonia ligase) (CT... 28 8.5
>sp|Q58667|LEUD1_METJA 3-isopropylmalate dehydratase small subunit 1 (Isopropylmalate isomerase 1) (Alpha-IPM isomerase 1) (IPMI 1) Length = 170 Score = 31.6 bits (70), Expect = 0.59 Identities = 14/44 (31%), Positives = 27/44 (61%) Frame = +3 Query: 30 IVDTEVDGDSNVIKIAFDTKEIIINCRSLTVQCYQDKKLESIVL 161 I +T+ D ++++I D +EI+I ++ T++C K LE +L Sbjct: 104 IANTDEIKDGDIVEIDLDKEEIVITNKNKTIKCETPKGLEREIL 147
>sp|O33102|DNLJ_MYCLE DNA ligase (Polydeoxyribonucleotide synthase [NAD+]) Length = 694 Score = 27.7 bits (60), Expect = 8.5 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +2 Query: 137 QEVREHCFRYYSTLVPLLDASKGIDFAIEAIFEKIVV 247 +EVREH FRYY P++ D +A+ +++ V Sbjct: 22 EEVREHQFRYYVRDAPIIS-----DAEFDALLDRLTV 53
>sp|Q8EM53|PYRG_OCEIH CTP synthase (UTP--ammonia ligase) (CTP synthetase) Length = 535 Score = 27.7 bits (60), Expect = 8.5 Identities = 14/42 (33%), Positives = 24/42 (57%) Frame = +2 Query: 104 LSFIDGTMLSRQEVREHCFRYYSTLVPLLDASKGIDFAIEAI 229 + +I+ +LS ++++E + LVP +GID IEAI Sbjct: 326 IHWINSELLSEEQIKEELSKVDGVLVPGGFGDRGIDGKIEAI 367
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,401,664 Number of Sequences: 369166 Number of extensions: 611198 Number of successful extensions: 1593 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1574 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1593 length of database: 68,354,980 effective HSP length: 75 effective length of database: 54,499,855 effective search space used: 1689495505 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)