Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_007_N01 (519 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q9CPV7|ZDHC6_MOUSE Probable palmitoyltransferase ZDHHC6 ... 55 1e-07 sp|Q9H6R6|ZDHC6_HUMAN Probable palmitoyltransferase ZDHHC6 ... 48 2e-05 sp|Q98936|PTPRG_CHICK Receptor-type tyrosine-protein phosph... 29 7.7
>sp|Q9CPV7|ZDHC6_MOUSE Probable palmitoyltransferase ZDHHC6 (Zinc finger DHHC domain-containing protein 6) (DHHC-6) (H4 homolog) Length = 413 Score = 54.7 bits (130), Expect = 1e-07 Identities = 33/120 (27%), Positives = 55/120 (45%) Frame = +1 Query: 4 SQNYEIRRSYNGGLFPVISFGCRVVYGSPCTDENRLPVKPGQIVMVTRWRKHWLYGQILX 183 S Y++ YNG P ++ G R + SPCT+E R+ ++ G+ ++ TR ++WLYG + Sbjct: 315 SVRYKVIEDYNGACCP-LNRGVRTFFTSPCTEEPRIRLQKGEFILATRGLRYWLYGDKI- 372 Query: 184 XXXXXXXXXXXXXXXVESSQQRRVATKRANSRGWFPAVCARQKYLGGEDGPAVPQKADRN 363 +E + + RGWFP C + G+ PA P+ +N Sbjct: 373 ----------LDDSFIEGT---------SRVRGWFPRNCVEKCPCDGDSDPA-PEGEKKN 412
>sp|Q9H6R6|ZDHC6_HUMAN Probable palmitoyltransferase ZDHHC6 (Zinc finger DHHC domain-containing protein 6) (DHHC-6) (Zinc finger protein 376) (Transmembrane protein H4) sp|Q5REH2|ZDHC6_PONPY Probable palmitoyltransferase ZDHHC6 (Zinc finger DHHC domain-containing protein 6) (DHHC-6) Length = 413 Score = 47.8 bits (112), Expect = 2e-05 Identities = 27/102 (26%), Positives = 48/102 (47%) Frame = +1 Query: 4 SQNYEIRRSYNGGLFPVISFGCRVVYGSPCTDENRLPVKPGQIVMVTRWRKHWLYGQILX 183 S Y++ Y+G P ++ G + + SPCT+E R+ ++ G+ ++ TR ++WLYG + Sbjct: 315 SVRYKVIEDYSGACCP-LNKGIKTFFTSPCTEEPRIQLQKGEFILATRGLRYWLYGDKI- 372 Query: 184 XXXXXXXXXXXXXXXVESSQQRRVATKRANSRGWFPAVCARQ 309 ++ S V + RGWFP C + Sbjct: 373 ---------------LDDSFIEGV----SRIRGWFPRKCVEK 395
>sp|Q98936|PTPRG_CHICK Receptor-type tyrosine-protein phosphatase gamma precursor (Protein-tyrosine phosphatase gamma) (R-PTP-gamma) Length = 1422 Score = 28.9 bits (63), Expect = 7.7 Identities = 11/33 (33%), Positives = 22/33 (66%) Frame = +2 Query: 272 TVEDGSQPCALDRNISVVKTDQRSPRRPIETVI 370 T E+G+ P LD+N +V+ +D+ P +E+++ Sbjct: 1390 TKENGNGPMTLDKNGAVMASDESDPAESMESLV 1422
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,794,794 Number of Sequences: 369166 Number of extensions: 1229070 Number of successful extensions: 3550 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3457 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3549 length of database: 68,354,980 effective HSP length: 103 effective length of database: 49,327,275 effective search space used: 3403581975 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)