Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_007_K23 (447 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P22495|POLS_IPNVN Structural polyprotein [Contains: Majo... 32 0.64 sp|P05844|POLS_IPNVJ Structural polyprotein [Contains: Majo... 29 4.1
>sp|P22495|POLS_IPNVN Structural polyprotein [Contains: Major structural protein VP2; Nonstructural protein VP4 (Protease); Minor structural protein VP3] Length = 972 Score = 32.0 bits (71), Expect = 0.64 Identities = 15/48 (31%), Positives = 27/48 (56%) Frame = +3 Query: 138 STLLKYSMLPVVSCACIPCQMSD*HLIAQDSPQIKLHINDFGYCDLIC 281 +T LK MLP A IP +++ H++ Q++ L +++ G L+C Sbjct: 8 ATYLKSIMLPETGPASIPDDITERHILKQETSSYNLEVSESGSGILVC 55
>sp|P05844|POLS_IPNVJ Structural polyprotein [Contains: Major structural protein VP2; Nonstructural protein VP4 (Protease); Minor structural protein VP3] Length = 972 Score = 29.3 bits (64), Expect = 4.1 Identities = 14/48 (29%), Positives = 27/48 (56%) Frame = +3 Query: 138 STLLKYSMLPVVSCACIPCQMSD*HLIAQDSPQIKLHINDFGYCDLIC 281 +T L+ MLP A IP +++ H++ Q++ L +++ G L+C Sbjct: 8 ATYLRSIMLPENGPASIPDDITERHILKQETSSYNLEVSESGSGLLVC 55
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,465,626 Number of Sequences: 369166 Number of extensions: 682317 Number of successful extensions: 1092 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1084 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1091 length of database: 68,354,980 effective HSP length: 100 effective length of database: 49,881,480 effective search space used: 2394311040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)