Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= Dr_sW_007_K18
(542 letters)
Database: Non-redundant SwissProt sequences
184,735 sequences; 68,354,980 total letters
Score E
Sequences producing significant alignments: (bits) Value
sp|P17663|FRIH1_XENLA Ferritin heavy chain 1 64 3e-10
sp|P49948|FRIH2_XENLA Ferritin heavy chain 2 (XL2-17) 63 5e-10
sp|P07798|FRI2_RANCA Ferritin, middle subunit (Ferritin M) ... 62 1e-09
sp|P49947|FRIM_SALSA Ferritin, middle subunit (Ferritin M) 59 6e-09
sp|P07229|FRI1_RANCA Ferritin, higher subunit (Ferritin H) 59 8e-09
sp|P42577|FRIS_LYMST Soma ferritin 59 1e-08
sp|P25915|FRIH_RABIT Ferritin heavy chain (Ferritin H subunit) 59 1e-08
sp|P08267|FRIH_CHICK Ferritin heavy chain (Ferritin H subunit) 58 1e-08
sp|Q5R8J7|FRIH_PONPY Ferritin heavy chain (Ferritin H subunit) 57 2e-08
sp|Q7SXA5|FRIL_XENLA Ferritin light chain, oocyte isoform (... 57 2e-08
>sp|P17663|FRIH1_XENLA Ferritin heavy chain 1
Length = 176
Score = 63.5 bits (153), Expect = 3e-10
Identities = 34/98 (34%), Positives = 52/98 (53%)
Frame = +1
Query: 19 EGRYTEELIRFQVNRGQKVTWYDVKPVEHIETPKPFEMFQTILNLEKDVHQNTLRLCKLA 198
E + E+ +++Q RG +V D+K E E E Q L LEK V+Q L L KLA
Sbjct: 59 EREHAEKFLKYQNKRGGRVVLQDIKKPERDEWSNTLEAMQAALQLEKTVNQALLDLHKLA 118
Query: 199 CEKLDVDLTSFLKDRVILRQIKVIRKRASQLRNLRRSG 312
+K+D L FL+ + Q+K +++ + NL+R G
Sbjct: 119 SDKVDPQLCDFLESEYLEEQVKAMKELGDYITNLKRLG 156
>sp|P49948|FRIH2_XENLA Ferritin heavy chain 2 (XL2-17)
Length = 176
Score = 62.8 bits (151), Expect = 5e-10
Identities = 34/98 (34%), Positives = 52/98 (53%)
Frame = +1
Query: 19 EGRYTEELIRFQVNRGQKVTWYDVKPVEHIETPKPFEMFQTILNLEKDVHQNTLRLCKLA 198
E + E+ +++Q RG +V D+K E E E Q L LEK V+Q L L KLA
Sbjct: 59 EREHAEKFLKYQNKRGGRVVLQDIKKPERDEWGNTLEATQAALQLEKTVNQALLDLHKLA 118
Query: 199 CEKLDVDLTSFLKDRVILRQIKVIRKRASQLRNLRRSG 312
+K+D L FL+ + Q+K +++ + NL+R G
Sbjct: 119 SDKVDAHLCDFLESEYLEEQVKAMKQLGDYITNLKRLG 156
>sp|P07798|FRI2_RANCA Ferritin, middle subunit (Ferritin M) (Ferritin X) (Ferritin H')
Length = 176
Score = 61.6 bits (148), Expect = 1e-09
Identities = 35/98 (35%), Positives = 52/98 (53%)
Frame = +1
Query: 19 EGRYTEELIRFQVNRGQKVTWYDVKPVEHIETPKPFEMFQTILNLEKDVHQNTLRLCKLA 198
E + E+ +++Q RG +V D+K E E E Q L LEK V+Q L L KLA
Sbjct: 59 EREHAEKFMKYQNKRGGRVVLQDIKKPERDEWGNTLEAMQAALQLEKTVNQALLDLHKLA 118
Query: 199 CEKLDVDLTSFLKDRVILRQIKVIRKRASQLRNLRRSG 312
+K+D L FL+ + Q+K I++ + NL+R G
Sbjct: 119 TDKVDPHLCDFLESEYLEEQVKDIKRIGDFITNLKRLG 156
>sp|P49947|FRIM_SALSA Ferritin, middle subunit (Ferritin M)
Length = 176
Score = 59.3 bits (142), Expect = 6e-09
Identities = 36/115 (31%), Positives = 58/115 (50%)
Frame = +1
Query: 19 EGRYTEELIRFQVNRGQKVTWYDVKPVEHIETPKPFEMFQTILNLEKDVHQNTLRLCKLA 198
E + ++L+ FQ RG ++ D+K E E E Q L LEK+V+Q L L K+A
Sbjct: 59 EREHADKLLSFQNKRGGRILLQDIKKPERDEWGNGLEAMQCALQLEKNVNQALLDLHKIA 118
Query: 199 CEKLDVDLTSFLKDRVILRQIKVIRKRASQLRNLRRSGDDVTPFLTSSLHARHEI 363
+K+D L FL+ + Q++ I+K + NL + D V + L +H +
Sbjct: 119 SDKVDPHLCDFLETHYLNEQVEAIKKLGDHITNLTKM-DAVKNKMAEYLFDKHTL 172
>sp|P07229|FRI1_RANCA Ferritin, higher subunit (Ferritin H)
Length = 176
Score = 58.9 bits (141), Expect = 8e-09
Identities = 34/98 (34%), Positives = 51/98 (52%)
Frame = +1
Query: 19 EGRYTEELIRFQVNRGQKVTWYDVKPVEHIETPKPFEMFQTILNLEKDVHQNTLRLCKLA 198
E + E+L++ Q RG ++ DVK E E E Q L LEK V+Q L L K+
Sbjct: 59 EREHAEKLMKDQNKRGGRIVLQDVKKPERDEWGNTLEAMQAALQLEKTVNQALLDLHKVG 118
Query: 199 CEKLDVDLTSFLKDRVILRQIKVIRKRASQLRNLRRSG 312
+K+D L FL+ + Q+K I++ + NL+R G
Sbjct: 119 SDKVDPHLCDFLETEYLEEQVKSIKQLGDYITNLKRLG 156
>sp|P42577|FRIS_LYMST Soma ferritin
Length = 174
Score = 58.5 bits (140), Expect = 1e-08
Identities = 31/105 (29%), Positives = 54/105 (51%)
Frame = +1
Query: 19 EGRYTEELIRFQVNRGQKVTWYDVKPVEHIETPKPFEMFQTILNLEKDVHQNTLRLCKLA 198
E + E+L+++Q RG ++ D+K + E E Q L LEK V+Q+ L L KL
Sbjct: 60 EREHAEKLMKYQNKRGGRIVLQDIKKPDRDEWGTGLEAMQVALQLEKSVNQSLLDLHKLC 119
Query: 199 CEKLDVDLTSFLKDRVILRQIKVIRKRASQLRNLRRSGDDVTPFL 333
D + FL+ + Q+K I++ + + NL+R G + ++
Sbjct: 120 TSHDDAQMADFLESEFLEEQVKSIKELSDYITNLKRVGPGLGEYI 164
>sp|P25915|FRIH_RABIT Ferritin heavy chain (Ferritin H subunit)
Length = 164
Score = 58.5 bits (140), Expect = 1e-08
Identities = 31/98 (31%), Positives = 53/98 (54%)
Frame = +1
Query: 19 EGRYTEELIRFQVNRGQKVTWYDVKPVEHIETPKPFEMFQTILNLEKDVHQNTLRLCKLA 198
E + E+L++ Q RG ++ D+K E+ + + L+LEK V+Q+ L L KLA
Sbjct: 44 EREHAEKLMKLQNQRGGRIFLQDIKKPEYDDWESGLNAMECALHLEKSVNQSLLELHKLA 103
Query: 199 CEKLDVDLTSFLKDRVILRQIKVIRKRASQLRNLRRSG 312
+K D L F++ + Q+K I++ + NLR+ G
Sbjct: 104 TDKNDPHLCDFIETHYLNEQVKSIKELGDHVTNLRKMG 141
>sp|P08267|FRIH_CHICK Ferritin heavy chain (Ferritin H subunit)
Length = 180
Score = 58.2 bits (139), Expect = 1e-08
Identities = 31/98 (31%), Positives = 53/98 (54%)
Frame = +1
Query: 19 EGRYTEELIRFQVNRGQKVTWYDVKPVEHIETPKPFEMFQTILNLEKDVHQNTLRLCKLA 198
E + E+L++ Q RG ++ D+K + + + L+LEK+V+Q+ L L KLA
Sbjct: 62 EREHAEKLMKLQNQRGGRIFLQDIKKPDRDDWENGLTAMECALHLEKNVNQSLLELHKLA 121
Query: 199 CEKLDVDLTSFLKDRVILRQIKVIRKRASQLRNLRRSG 312
EK D L F++ + Q+K I++ + NLR+ G
Sbjct: 122 TEKNDPHLCDFIETHYLDEQVKAIKQLGDHVTNLRKMG 159
>sp|Q5R8J7|FRIH_PONPY Ferritin heavy chain (Ferritin H subunit)
Length = 183
Score = 57.4 bits (137), Expect = 2e-08
Identities = 31/98 (31%), Positives = 53/98 (54%)
Frame = +1
Query: 19 EGRYTEELIRFQVNRGQKVTWYDVKPVEHIETPKPFEMFQTILNLEKDVHQNTLRLCKLA 198
E + E+L++ Q RG ++ D+K + + + L+LEK+V+Q+ L L KLA
Sbjct: 63 EREHAEKLMKLQNQRGGRIFLQDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHKLA 122
Query: 199 CEKLDVDLTSFLKDRVILRQIKVIRKRASQLRNLRRSG 312
+K D L FL+ + Q+K I++ + NLR+ G
Sbjct: 123 TDKNDPHLCDFLETHYLNEQVKAIKELGDHVTNLRKMG 160
>sp|Q7SXA5|FRIL_XENLA Ferritin light chain, oocyte isoform (B-ferritin) (XeBF) (GV-LCH)
Length = 177
Score = 57.4 bits (137), Expect = 2e-08
Identities = 30/93 (32%), Positives = 50/93 (53%)
Frame = +1
Query: 28 YTEELIRFQVNRGQKVTWYDVKPVEHIETPKPFEMFQTILNLEKDVHQNTLRLCKLACEK 207
+ E+ ++FQ RG +V DVK + E + + LNLEK ++Q L L K+A +
Sbjct: 64 HAEDFLKFQNKRGGRVVLQDVKKPDDDEWGNGTKAMEVALNLEKSINQAVLDLHKIATDH 123
Query: 208 LDVDLTSFLKDRVILRQIKVIRKRASQLRNLRR 306
D + +L+ + ++K+I+K L NLRR
Sbjct: 124 TDPHMQDYLEHEFLEEEVKLIKKLGDHLTNLRR 156
Database: Non-redundant SwissProt sequences
Posted date: Dec 6, 2005 7:40 AM
Number of letters in database: 68,354,980
Number of sequences in database: 184,735
Database: swissprot.01
Posted date: Dec 6, 2005 8:18 AM
Number of letters in database: 66,202,850
Number of sequences in database: 184,431
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 52,404,654
Number of Sequences: 369166
Number of extensions: 922391
Number of successful extensions: 2327
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 2288
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2327
length of database: 68,354,980
effective HSP length: 104
effective length of database: 49,142,540
effective search space used: 3734833040
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)