Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_007_F19-2 (372 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|O13811|PDI2_SCHPO Putative protein disulfide-isomerase C... 30 1.3 sp|P40164|YNU1_YEAST Hypothetical 98.1 kDa protein in SPX19... 28 6.6 sp|Q81999|VE1_HPV72 Replication protein E1 28 6.6 sp|Q8N7E2|ZN645_HUMAN Zinc finger protein 645 28 6.6 sp|Q96DT7|ZBT10_HUMAN Zinc finger and BTB domain containing... 28 6.6 sp|Q9WTY8|ZBT10_RAT Zinc finger and BTB domain containing p... 28 6.6 sp|P54662|DEGU_BREBE Transcriptional regulatory protein degU 28 6.6 sp|Q9T0E0|PMAX_ARATH Putative ATPase, plasma membrane-like 28 8.6 sp|Q9VVN6|CP312_DROME Probable cytochrome P450 312a1 (CYPCC... 28 8.6 sp|Q8PI37|GCST_XANAC Aminomethyltransferase (Glycine cleava... 28 8.6
>sp|O13811|PDI2_SCHPO Putative protein disulfide-isomerase C17H9.14c precursor Length = 359 Score = 30.4 bits (67), Expect = 1.3 Identities = 33/102 (32%), Positives = 46/102 (45%), Gaps = 2/102 (1%) Frame = +3 Query: 21 YCNKLFPKKEHMCKKFLKNELPNI-LNKLRVSIHRDYLCNSTCNGKLSKDWIVSF-TEHF 194 YC +L P E + K F KNE PN+ + K+ + D G+L + + SF T F Sbjct: 172 YCKRLAPTYETLGKVF-KNE-PNVEIVKINADVFADI-------GRLHE--VASFPTIKF 220 Query: 195 FTNEDKKCPACKYVSKILKSLIRSSGFKAAVIRSFQQTQCKT 320 F +DK P + L+SLI K+ RS T T Sbjct: 221 FPKDDKDKPELYEGDRSLESLIEYINKKSGTQRSPDGTLLST 262
>sp|P40164|YNU1_YEAST Hypothetical 98.1 kDa protein in SPX19-GCR2 intergenic region Length = 858 Score = 28.1 bits (61), Expect = 6.6 Identities = 16/47 (34%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = +3 Query: 123 DYLCNSTCNGKLSKDWIVSFTEHFFTNEDKKCPACKY-VSKILKSLI 260 D+L N T L ++I + HF E++K P + +S I+K+LI Sbjct: 181 DFLKNETIEFILQSNYIDTLISHFHKAEEEKIPKDLFLLSNIIKTLI 227
>sp|Q81999|VE1_HPV72 Replication protein E1 Length = 650 Score = 28.1 bits (61), Expect = 6.6 Identities = 18/48 (37%), Positives = 25/48 (52%) Frame = -3 Query: 322 NVLHWVC*KLLITAALNPLDRINDFKIFETYLHAGHFLSSFVKKCSVK 179 N+ C L+IT +NPL+ FK YLH+ L F+ KC +K Sbjct: 552 NLTQLKCPPLMITTNINPLED-QAFK----YLHSRIVLFKFMHKCPLK 594
>sp|Q8N7E2|ZN645_HUMAN Zinc finger protein 645 Length = 425 Score = 28.1 bits (61), Expect = 6.6 Identities = 16/52 (30%), Positives = 28/52 (53%) Frame = +3 Query: 210 KKCPACKYVSKILKSLIRSSGFKAAVIRSFQQTQCKTLFLATKRVCKFHISR 365 K CP C+Y +++ R S F ++++ QCK +L+ K + + HI R Sbjct: 91 KVCPRCRYPVLRIEAHKRGSVFMCSIVQ-----QCKRTYLSQKSL-QAHIKR 136
>sp|Q96DT7|ZBT10_HUMAN Zinc finger and BTB domain containing protein 10 (Zinc finger protein RIN ZF) Length = 847 Score = 28.1 bits (61), Expect = 6.6 Identities = 17/44 (38%), Positives = 21/44 (47%) Frame = +3 Query: 213 KCPACKYVSKILKSLIRSSGFKAAVIRSFQQTQCKTLFLATKRV 344 KCP C YV+K ++L R V RSF C LF + V Sbjct: 699 KCPHCSYVAKYRRTLKRHLLIHTGV-RSFSCDICGKLFTRREHV 741
>sp|Q9WTY8|ZBT10_RAT Zinc finger and BTB domain containing protein 10 (Zinc finger protein RIN ZF) Length = 836 Score = 28.1 bits (61), Expect = 6.6 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = +3 Query: 213 KCPACKYVSKILKSLIRSSGFKAAVIRSFQQTQCKTLFLATKRV 344 KCP C YV+K ++L R + V RSF+ C +F + V Sbjct: 690 KCPHCSYVAKYRRTLKRHLLIHSGV-RSFKCEICGKMFTRREHV 732
>sp|P54662|DEGU_BREBE Transcriptional regulatory protein degU Length = 236 Score = 28.1 bits (61), Expect = 6.6 Identities = 13/44 (29%), Positives = 24/44 (54%) Frame = +3 Query: 21 YCNKLFPKKEHMCKKFLKNELPNILNKLRVSIHRDYLCNSTCNG 152 Y N++ + ++ +K +KN + NIL K+ V+ + S NG Sbjct: 188 YSNRMIGEALYISEKTVKNHVSNILQKMNVNDRTQAVVESIKNG 231
>sp|Q9T0E0|PMAX_ARATH Putative ATPase, plasma membrane-like Length = 813 Score = 27.7 bits (60), Expect = 8.6 Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 6/54 (11%) Frame = +3 Query: 216 CPACKYVSKILKSLIRS---SGFKAAVIRSFQQTQCKTLFLATKRVC---KFHI 359 C A + K + S IR+ G K+ I F+ T C T+F ++C K+HI Sbjct: 432 CNARDDLRKSVHSAIRNYAERGLKSFAISWFRNTNCNTVFFFPYQLCSEHKYHI 485
>sp|Q9VVN6|CP312_DROME Probable cytochrome P450 312a1 (CYPCCCXIIA1) Length = 510 Score = 27.7 bits (60), Expect = 8.6 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = -3 Query: 289 ITAALNPLDRINDFKIFETYLHAGHFLSSFVK 194 + +A L + ND+++FE +L G F S F K Sbjct: 95 LCSAQQLLQKTNDYRVFENWLCEGLFTSGFEK 126
>sp|Q8PI37|GCST_XANAC Aminomethyltransferase (Glycine cleavage system T protein) Length = 369 Score = 27.7 bits (60), Expect = 8.6 Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = +3 Query: 60 KKFLKNELPNILNKLRVSIHRDYLCNSTCNGKLSKDWIVSF-TEHFF 197 ++FL+ L N ++KL+VS Y C G + D IV + TE FF Sbjct: 63 REFLRYLLANSVDKLKVSGKALYTCMLNPQGGVIDDLIVYYMTEDFF 109
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,056,053 Number of Sequences: 369166 Number of extensions: 771388 Number of successful extensions: 2580 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 2540 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2580 length of database: 68,354,980 effective HSP length: 90 effective length of database: 51,728,830 effective search space used: 1707051390 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)