Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_007_D13 (745 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q07848|VE1_HPV65 Replication protein E1 40 0.009 sp|Q07846|VE1_HPV04 Replication protein E1 33 0.80 sp|P30518|V2R_HUMAN Vasopressin V2 receptor (Renal-type arg... 32 2.3 sp|Q6FU50|LHS1_CANGA Heat shock protein 70 homolog LHS1 pre... 31 3.1 sp|O62479|SAS6_CAEEL Spindle assembly abnormal protein 6 30 6.8 sp|P17256|KIME_RAT Mevalonate kinase (MK) 30 8.9 sp|Q9PRB5|Y030_UREPA Hypothetical protein UU030 30 8.9
>sp|Q07848|VE1_HPV65 Replication protein E1 Length = 598 Score = 39.7 bits (91), Expect = 0.009 Identities = 28/96 (29%), Positives = 43/96 (44%) Frame = +1 Query: 178 NKDLIGSISELISSAERTDESSPVPHKTFSEDAIAQILQEYQSLVDRFQSKGLLDENDLI 357 N DL GS ++ AE TD S D + + E S V ++D+ Sbjct: 8 NFDLEGSSWYIVHEAECTD----------SIDTLEDLCDESDSNVSNLIDDDVVDQ---- 53 Query: 358 GNALGFFHSKIDRLCDNEVAHVAGKYEDFNSKRIEE 465 GN+L +++KI CDN +AH+ KY + + E Sbjct: 54 GNSLALYNAKITDDCDNAIAHLKRKYNKSPEQAVAE 89
>sp|Q07846|VE1_HPV04 Replication protein E1 Length = 599 Score = 33.1 bits (74), Expect = 0.80 Identities = 27/98 (27%), Positives = 46/98 (46%), Gaps = 2/98 (2%) Frame = +1 Query: 178 NKDLIGSISELISSAERTDESSPVPHKTFSEDAIAQILQEYQSLVDRFQSKGLLDENDLI 357 N DL G+ ++ AE TD S D + + E D L+D+ D++ Sbjct: 8 NFDLEGNNWYIVHEAECTD----------SIDTLDDLCDESN---DDSNISNLIDD-DVV 53 Query: 358 --GNALGFFHSKIDRLCDNEVAHVAGKYEDFNSKRIEE 465 GN+L ++++I+ CDN +AH+ KY + + E Sbjct: 54 DQGNSLALYNAQINEDCDNALAHLKRKYNKSPEQAVAE 91
>sp|P30518|V2R_HUMAN Vasopressin V2 receptor (Renal-type arginine vasopressin receptor) (Antidiuretic hormone receptor) (AVPR V2) Length = 371 Score = 31.6 bits (70), Expect = 2.3 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = -1 Query: 709 CAEPRISASFCVSNSPDSQGLIYCSKNAFPPSFGLLTKLC 590 C P I ASF S S + + L+ C++ PPS G + C Sbjct: 319 CTNPWIYASFSSSVSSELRSLLCCARGRTPPSLGPQDESC 358
>sp|Q6FU50|LHS1_CANGA Heat shock protein 70 homolog LHS1 precursor Length = 889 Score = 31.2 bits (69), Expect = 3.1 Identities = 23/72 (31%), Positives = 35/72 (48%), Gaps = 4/72 (5%) Frame = +1 Query: 37 IKDNENDVEMINYLQNNIGFLGLALHEKFDLLLSKLEVS----INDGNVKLNKDLIGSIS 204 + D EN E N + GL + EK++ +LSK+ S ++ N+K LI ++ Sbjct: 700 LADLENKAEKFNVI-------GLNVTEKYNSILSKMSFSSIRRSSEENIKTLAGLIDEVN 752 Query: 205 ELISSAERTDES 240 E I S DES Sbjct: 753 ESIKSKAIDDES 764
>sp|O62479|SAS6_CAEEL Spindle assembly abnormal protein 6 Length = 492 Score = 30.0 bits (66), Expect = 6.8 Identities = 16/51 (31%), Positives = 28/51 (54%) Frame = +1 Query: 268 EDAIAQILQEYQSLVDRFQSKGLLDENDLIGNALGFFHSKIDRLCDNEVAH 420 ED +A + Q+ +SL + + +E +++GN L K+D+L VAH Sbjct: 253 EDEVADLKQDTESLQKQLEENQ--EELEIVGNMLREEQGKVDQLQKRNVAH 301
>sp|P17256|KIME_RAT Mevalonate kinase (MK) Length = 395 Score = 29.6 bits (65), Expect = 8.9 Identities = 18/55 (32%), Positives = 27/55 (49%) Frame = +1 Query: 256 KTFSEDAIAQILQEYQSLVDRFQSKGLLDENDLIGNALGFFHSKIDRLCDNEVAH 420 + E A A + ++Y L + L+D N NALG H+ +D+LC AH Sbjct: 277 RVLGEMAAAPVPEQYLVLEE------LMDMNQHHLNALGVGHASLDQLCQVTAAH 325
>sp|Q9PRB5|Y030_UREPA Hypothetical protein UU030 Length = 747 Score = 29.6 bits (65), Expect = 8.9 Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 6/40 (15%) Frame = +1 Query: 25 HLDLIKDNE------NDVEMINYLQNNIGFLGLALHEKFD 126 +L + KDN N E INYL+NN GF+ ++E D Sbjct: 416 NLAISKDNRMKSRWFNKQEYINYLENNAGFISSNIYEDKD 455
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 80,020,385 Number of Sequences: 369166 Number of extensions: 1537842 Number of successful extensions: 4514 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 4373 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4514 length of database: 68,354,980 effective HSP length: 108 effective length of database: 48,403,600 effective search space used: 6728100400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)