Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_006_M02 (429 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q75A47|NO14_ASHGO Probable nucleolar complex protein 14 32 0.56 sp|Q12830|FALZ_HUMAN Fetal Alzheimer antigen (Fetal Alz-50-... 29 3.6 sp|P34781|YCX7_ASTLO Hypothetical 9.2 kDa protein in rpl23-... 28 6.2
>sp|Q75A47|NO14_ASHGO Probable nucleolar complex protein 14 Length = 806 Score = 32.0 bits (71), Expect = 0.56 Identities = 18/58 (31%), Positives = 26/58 (44%) Frame = +3 Query: 141 KPAEEMKNENPEEIDLNDVXXXXXXXXTVCGNDKPGIEQYDPADYPAEESDKEDENGY 314 K EEMK E E++ ++ V G D G+E D + AE+SD + Y Sbjct: 289 KTDEEMKQEREEKLKKLELDRVNRMNGLVDGEDAQGVEDLDNGFWEAEDSDAGEYGEY 346
>sp|Q12830|FALZ_HUMAN Fetal Alzheimer antigen (Fetal Alz-50-reactive clone 1) Length = 810 Score = 29.3 bits (64), Expect = 3.6 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +3 Query: 252 EQYDPADYPAEESDKEDENGYCPMTPFV*SPIYST 356 E D +DYP E D +D+ YC + F YS+ Sbjct: 29 EDDDDSDYPEEMEDDDDDASYCTESSFRSHSTYSS 63
>sp|P34781|YCX7_ASTLO Hypothetical 9.2 kDa protein in rpl23-rpl2 intergenic region (ORF76) Length = 76 Score = 28.5 bits (62), Expect = 6.2 Identities = 20/55 (36%), Positives = 27/55 (49%), Gaps = 6/55 (10%) Frame = -2 Query: 305 FIFLITFL-CRIICGIILLYPRLVVAAHCF--RFFIFT*NI---IKIYFLRIFIF 159 F+F ITFL C + IIL + F +I NI IK+YF+ F+F Sbjct: 22 FVFAITFLMCNVEAAIILKSLSIFTKCKYFYDNIYIIFYNIFYCIKLYFINFFVF 76
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,718,235 Number of Sequences: 369166 Number of extensions: 689093 Number of successful extensions: 1964 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1939 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1961 length of database: 68,354,980 effective HSP length: 100 effective length of database: 49,881,480 effective search space used: 2095022160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)