Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_006_L15-2 (339 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P18848|ATF4_HUMAN Cyclic AMP-dependent transcription fac... 30 1.7 sp|Q9WTN3|SRBP1_MOUSE Sterol regulatory element binding pro... 30 1.7 sp|Q890I8|GLGA_LACPL Glycogen synthase (Starch [bacterial g... 30 2.3 sp|Q9ZZT7|CYB_ELIQU Cytochrome b 29 3.0 sp|Q9UNA0|ATS5_HUMAN ADAMTS-5 precursor (A disintegrin and ... 29 3.9 sp|Q9B205|CYB_CAICR Cytochrome b 28 5.1 sp|P52383|VU51_HHV7J G-protein coupled receptor homolog U51 28 6.6 sp|O75161|NPH4_HUMAN Nephrocystin-4 (Nephroretinin) 28 6.6 sp|Q9UPU5|UBP24_HUMAN Ubiquitin carboxyl-terminal hydrolase... 28 6.6 sp|Q06507|ATF4_MOUSE Cyclic AMP-dependent transcription fac... 28 8.6
>sp|P18848|ATF4_HUMAN Cyclic AMP-dependent transcription factor ATF-4 (Activating transcription factor 4) (DNA-binding protein TAXREB67) (Cyclic AMP response element-binding protein 2) (CREB2) Length = 351 Score = 30.0 bits (66), Expect = 1.7 Identities = 16/50 (32%), Positives = 25/50 (50%) Frame = -2 Query: 197 TPLYPQCAPFSPSIIDPTSREPSCITRTI*HLPPAYTAPPGIFPFS*RSP 48 T L C F+P ++ T+++P I HLP + T P + PF+ P Sbjct: 114 TTLDDTCDLFAP-LVQETNKQPPQTVNPIGHLPESLTKPDQVAPFTFLQP 162
>sp|Q9WTN3|SRBP1_MOUSE Sterol regulatory element binding protein 1 (SREBP-1) (Sterol regulatory element-binding transcription factor 1) Length = 1134 Score = 30.0 bits (66), Expect = 1.7 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 11/52 (21%) Frame = -2 Query: 200 ATPLYPQCAPFSP-----------SIIDPTSREPSCITRTI*HLPPAYTAPP 78 A +YP +PFSP +I+ P + +PS T LPP++ APP Sbjct: 104 ALKMYPSVSPFSPGPGIKEEPVPLTILQPAAPQPSPGTL----LPPSFPAPP 151
>sp|Q890I8|GLGA_LACPL Glycogen synthase (Starch [bacterial glycogen] synthase) Length = 479 Score = 29.6 bits (65), Expect = 2.3 Identities = 12/43 (27%), Positives = 20/43 (46%) Frame = +1 Query: 163 GENGAHCGYKGVAYSHYEYQIFVETEIKNSTKLRWKWTDGKKF 291 GE+ +CG K + +H +Y + + L W DG +F Sbjct: 68 GEHAMYCGIKTLTVAHVQYYLIDNLDYFGREGLYGYWDDGARF 110
>sp|Q9ZZT7|CYB_ELIQU Cytochrome b Length = 379 Score = 29.3 bits (64), Expect = 3.0 Identities = 12/42 (28%), Positives = 22/42 (52%) Frame = -1 Query: 132 FMHNSNYIASSTCIHCTTWNISILMTFPFCLIVSLVFNYIVP 7 F+H I +C+ TWNI I++ F ++ + Y++P Sbjct: 95 FLHVGRGIYYGSCLFTETWNIGIILL--FAVMATAFMGYVLP 134
>sp|Q9UNA0|ATS5_HUMAN ADAMTS-5 precursor (A disintegrin and metalloproteinase with thrombospondin motifs 5) (ADAM-TS 5) (ADAM-TS5) (Aggrecanase-2) (ADMP-2) (ADAM-TS 11) Length = 930 Score = 28.9 bits (63), Expect = 3.9 Identities = 16/60 (26%), Positives = 27/60 (45%), Gaps = 8/60 (13%) Frame = +1 Query: 40 QTKGERHENGNIPGGAVYAGGRCYIVRVMHEGSRLVGSIIEGENG--------AHCGYKG 195 Q + + G G VYAGGR +++ + +GS + + G +HC Y+G Sbjct: 75 QNIDQLYSGGGKVGYLVYAGGRRFLLDLERDGSVGIAGFVPAGGGTSAPWRHRSHCFYRG 134
>sp|Q9B205|CYB_CAICR Cytochrome b Length = 383 Score = 28.5 bits (62), Expect = 5.1 Identities = 11/42 (26%), Positives = 23/42 (54%) Frame = -1 Query: 132 FMHNSNYIASSTCIHCTTWNISILMTFPFCLIVSLVFNYIVP 7 F+H + ++ +H TWN+ ++M F L+ + Y++P Sbjct: 96 FLHIGRGLYYASYLHENTWNVGVIML--FLLMATAFMGYVLP 135
>sp|P52383|VU51_HHV7J G-protein coupled receptor homolog U51 Length = 294 Score = 28.1 bits (61), Expect = 6.6 Identities = 19/71 (26%), Positives = 32/71 (45%), Gaps = 5/71 (7%) Frame = -1 Query: 327 ISIMTTHYCIFRKFLSICPFPSQFRTVFNLR-----FHKNLIFIMRISNSFVSAMCPIFS 163 ++ + TH +F F ++C FP+ FN H+ LI + + +V M I S Sbjct: 198 LNSIVTHLSLFLFFGALCFFPASVLNEFNCNRLFYGLHELLIVCLELKIFYVPTMTYIIS 257 Query: 162 FYN*PNKSRAF 130 N ++AF Sbjct: 258 CENYRLAAKAF 268
>sp|O75161|NPH4_HUMAN Nephrocystin-4 (Nephroretinin) Length = 1426 Score = 28.1 bits (61), Expect = 6.6 Identities = 13/21 (61%), Positives = 16/21 (76%), Gaps = 1/21 (4%) Frame = -3 Query: 334 TFYLHHDHP-LLHFQEISFHL 275 TF+LH DHP LL F+E SF + Sbjct: 1361 TFHLHSDHPELLRFREDSFQV 1381
>sp|Q9UPU5|UBP24_HUMAN Ubiquitin carboxyl-terminal hydrolase 24 (Ubiquitin thiolesterase 24) (Ubiquitin-specific processing protease 24) (Deubiquitinating enzyme 24) Length = 977 Score = 28.1 bits (61), Expect = 6.6 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = -1 Query: 135 AFMHNSNYIASSTCIHCTTWNISILMTFP 49 A MH+SN++ SS C C + +++ P Sbjct: 840 ALMHHSNHVDSSRCYQCVKFLVTLAQKCP 868
>sp|Q06507|ATF4_MOUSE Cyclic AMP-dependent transcription factor ATF-4 (C/EBP-related ATF) (C/ATF) (TAXREB67 homolog) Length = 349 Score = 27.7 bits (60), Expect = 8.6 Identities = 16/51 (31%), Positives = 24/51 (47%) Frame = -2 Query: 197 TPLYPQCAPFSPSIIDPTSREPSCITRTI*HLPPAYTAPPGIFPFS*RSPF 45 T L C F+P ++ T++EP I HLP + + PF+ PF Sbjct: 113 TTLDDTCDLFAP-LVQETNKEPPQTVNPIGHLPESLIKVDQVAPFTFLQPF 162
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.317 0.138 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,841,888 Number of Sequences: 369166 Number of extensions: 964311 Number of successful extensions: 2991 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 2942 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2986 length of database: 68,354,980 effective HSP length: 80 effective length of database: 53,576,180 effective search space used: 1714437760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)