Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_006_L11 (305 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q90508|VIT1_FUNHE Vitellogenin I precursor (VTG I) [Cont... 30 2.3 sp|P31911|HOXQ_RALEU Hydrogenase expression/formation prote... 28 8.6 sp|Q5HV27|SYH_CAMJR Histidyl-tRNA synthetase (Histidine--tR... 28 8.6
>sp|Q90508|VIT1_FUNHE Vitellogenin I precursor (VTG I) [Contains: Lipovitellin 1 (LV1); Phosvitin (PV); Lipovitellin 2 (LV2)] Length = 1704 Score = 29.6 bits (65), Expect = 2.3 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = +2 Query: 56 IKEDLNNCPAQLGAYLPPPNTKPKTIMCDTESKNNYEEYVDALTNNK 196 +K D QLG YL PN + + I+ + S +N+ DA+ +K Sbjct: 1257 VKADKRMVGYQLGFYLDKPNARVQIIVANISSDSNWRICADAVVLSK 1303
>sp|P31911|HOXQ_RALEU Hydrogenase expression/formation protein hoxQ Length = 282 Score = 27.7 bits (60), Expect = 8.6 Identities = 15/50 (30%), Positives = 25/50 (50%) Frame = +2 Query: 35 PVYKAFDIKEDLNNCPAQLGAYLPPPNTKPKTIMCDTESKNNYEEYVDAL 184 P +A D D + P + Y PP +P+ I C T++++ +DAL Sbjct: 13 PGSQAEDETLDYIHMPQGMSVYTPPVLPEPEQIACLTQAQSVLRAILDAL 62
>sp|Q5HV27|SYH_CAMJR Histidyl-tRNA synthetase (Histidine--tRNA ligase) (HisRS) sp|Q9PPF4|SYH_CAMJE Histidyl-tRNA synthetase (Histidine--tRNA ligase) (HisRS) Length = 408 Score = 27.7 bits (60), Expect = 8.6 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = +2 Query: 125 KTIMCDTESKNNYEEYVDALTNNKCTNCQ*PLET 226 + + C E N E L NN CT+CQ ET Sbjct: 201 RVLDCKNEHCQNLLENAPLLINNLCTSCQKDFET 234
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,291,134 Number of Sequences: 369166 Number of extensions: 615068 Number of successful extensions: 1258 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1245 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1258 length of database: 68,354,980 effective HSP length: 70 effective length of database: 55,423,530 effective search space used: 1718129430 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)