Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_006_F05-1 (262 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q9UTB8|INI1_SCHPO Pre-mRNA splicing factor ini1 29 2.9 sp|Q6FXI5|CIN8_CANGA Kinesin-like protein CIN8 28 8.4
>sp|Q9UTB8|INI1_SCHPO Pre-mRNA splicing factor ini1 Length = 117 Score = 29.3 bits (64), Expect = 2.9 Identities = 15/35 (42%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = +3 Query: 60 EKCPADNSFSWPNDCVRCCDEC-FPNADMTLFRCG 161 EKCP +S P VR CDEC F ++ CG Sbjct: 28 EKCPICDSHVRPTTLVRICDECAFGSSQDRCIICG 62
>sp|Q6FXI5|CIN8_CANGA Kinesin-like protein CIN8 Length = 988 Score = 27.7 bits (60), Expect = 8.4 Identities = 14/50 (28%), Positives = 27/50 (54%) Frame = -1 Query: 151 NKVISAFGKHSSQHLTQSLGHENELSAGHFSDVSTILISVIRKPMKAKSK 2 NK +S F +HS++ T S+G N++ ++ I+ V+ P ++ K Sbjct: 887 NKSLSLFKEHSTETATTSIGSVNKVE----GNLKVIMDKVLNDPQLSRGK 932
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25,364,760 Number of Sequences: 369166 Number of extensions: 389836 Number of successful extensions: 982 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 953 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 982 length of database: 68,354,980 effective HSP length: 57 effective length of database: 57,825,085 effective search space used: 1676927465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)