Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_006_E05 (540 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q58295|DPOL_METJA DNA polymerase [Contains: Mja pol-1 in... 34 0.26 sp|Q8N3Y1|FBXW8_HUMAN F-box/WD-repeat protein 8 (F-box and ... 30 2.9 sp|Q08204|SMC5_YEAST Structural maintenance of chromosome 5 30 3.7 sp|Q5HEQ1|RECX_STAAC Regulatory protein recX >gi|27805680|s... 29 6.4 sp|P66003|RECX_STAAN Regulatory protein recX >gi|54041803|s... 29 6.4 sp|Q15814|TBCC_HUMAN Tubulin-specific chaperone C (Tubulin-... 29 8.3 sp|Q9UTI6|ECT1_SCHPO Probable ethanolamine-phosphate cytidy... 29 8.3 sp|O67247|YB87_AQUAE Hypothetical protein AQ_1187 29 8.3
>sp|Q58295|DPOL_METJA DNA polymerase [Contains: Mja pol-1 intein; Mja pol-2 intein] Length = 1634 Score = 33.9 bits (76), Expect = 0.26 Identities = 16/42 (38%), Positives = 25/42 (59%) Frame = +3 Query: 303 EILDLVKDLLRLENDPAKLQRISKLLNDLNRKGYSFEKLRKK 428 +I + + DL+R D K IS++L N K +SF+K+ KK Sbjct: 902 KIGEYIDDLMRKHKDKIKFSGISEILETKNLKTFSFDKITKK 943
>sp|Q8N3Y1|FBXW8_HUMAN F-box/WD-repeat protein 8 (F-box and WD-40 domain protein 8) (F-box only protein 29) Length = 598 Score = 30.4 bits (67), Expect = 2.9 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -3 Query: 298 KRLFTVENIFSGIVCSSVSKRPPTIFVSGNPD 203 +RL + N+ C ++S PP + VSGN D Sbjct: 423 RRLLKLGNVLRDFTCVNLSDSPPNLMVSGNMD 454
>sp|Q08204|SMC5_YEAST Structural maintenance of chromosome 5 Length = 1093 Score = 30.0 bits (66), Expect = 3.7 Identities = 22/75 (29%), Positives = 37/75 (49%), Gaps = 4/75 (5%) Frame = +3 Query: 219 TNIVGGLLDTLEQTIPLNIFSTVKSLLNEILDLVKDLLRLENDPA----KLQRISKLLND 386 TN G + + EQ I I + + +L NE D L L N + +L ++ +D Sbjct: 643 TNFYQGSIMSNEQKI--RIENEIINLKNEYNDRKSTLDALSNQKSGYRHELSELASKNDD 700 Query: 387 LNRKGYSFEKLRKKY 431 +NR+ + ++RKKY Sbjct: 701 INREAHQLNEIRKKY 715
>sp|Q5HEQ1|RECX_STAAC Regulatory protein recX sp|Q8NVU3|RECX_STAAW Regulatory protein recX sp|Q6G861|RECX_STAAS Regulatory protein recX Length = 272 Score = 29.3 bits (64), Expect = 6.4 Identities = 18/67 (26%), Positives = 38/67 (56%), Gaps = 4/67 (5%) Frame = +3 Query: 240 LDTLEQTIPLNIFSTVKSLLNEILDLVKDLLRLENDPAKL----QRISKLLNDLNRKGYS 407 ++T+ + F+ +++L+++L +DL ++ N K + ISK + L RKGY Sbjct: 194 METIHAVLNEMDFTQDEAVLDDLLQ--RDLEKIYNKNRKKYTQQKLISKTIEGLMRKGYK 251 Query: 408 FEKLRKK 428 ++K++ K Sbjct: 252 YDKIKAK 258
>sp|P66003|RECX_STAAN Regulatory protein recX sp|P66002|RECX_STAAM Regulatory protein recX sp|Q6GFI4|RECX_STAAR Regulatory protein recX Length = 272 Score = 29.3 bits (64), Expect = 6.4 Identities = 18/67 (26%), Positives = 38/67 (56%), Gaps = 4/67 (5%) Frame = +3 Query: 240 LDTLEQTIPLNIFSTVKSLLNEILDLVKDLLRLENDPAKL----QRISKLLNDLNRKGYS 407 ++T+ + F+ +++L+++L +DL ++ N K + ISK + L RKGY Sbjct: 194 METIHAVLNEMDFTQDEAVLDDLLQ--RDLEKIYNKNRKKYTQQKLISKTIEGLMRKGYK 251 Query: 408 FEKLRKK 428 ++K++ K Sbjct: 252 YDKIKAK 258
>sp|Q15814|TBCC_HUMAN Tubulin-specific chaperone C (Tubulin-folding cofactor C) (CFC) Length = 346 Score = 28.9 bits (63), Expect = 8.3 Identities = 12/37 (32%), Positives = 24/37 (64%) Frame = +3 Query: 276 FSTVKSLLNEILDLVKDLLRLENDPAKLQRISKLLND 386 F+ ++ + E+L+ + + RLE ++LQ + KL+ND Sbjct: 64 FARERAAVEELLERAESVERLEEAASRLQGLQKLIND 100
>sp|Q9UTI6|ECT1_SCHPO Probable ethanolamine-phosphate cytidylyltransferase (Phosphorylethanolamine transferase) (CTP:phosphoethanolamine cytidylyltransferase) Length = 365 Score = 28.9 bits (63), Expect = 8.3 Identities = 13/29 (44%), Positives = 21/29 (72%) Frame = +3 Query: 237 LLDTLEQTIPLNIFSTVKSLLNEILDLVK 323 LLD L ++PL I+ST S+L+ +DL++ Sbjct: 135 LLDRLLSSVPLEIYSTPVSVLSSQIDLLR 163
>sp|O67247|YB87_AQUAE Hypothetical protein AQ_1187 Length = 167 Score = 28.9 bits (63), Expect = 8.3 Identities = 13/43 (30%), Positives = 27/43 (62%) Frame = +3 Query: 303 EILDLVKDLLRLENDPAKLQRISKLLNDLNRKGYSFEKLRKKY 431 +++++ ++LL++E K Q SK+++ LN GY ++ KY Sbjct: 25 KLVNIYRELLKVEETLKKGQINSKVIDKLNALGYPIYQIYSKY 67
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,635,099 Number of Sequences: 369166 Number of extensions: 710148 Number of successful extensions: 2398 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2356 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2398 length of database: 68,354,980 effective HSP length: 104 effective length of database: 49,142,540 effective search space used: 3685690500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)