Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_005_P09 (496 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P08492|HEMA_PI3H4 Hemagglutinin-neuraminidase 29 5.3 sp|Q9DHR2|MP44_YLDV Probable metalloendopeptidase G1-type 29 5.3
>sp|P08492|HEMA_PI3H4 Hemagglutinin-neuraminidase Length = 572 Score = 29.3 bits (64), Expect = 5.3 Identities = 16/41 (39%), Positives = 20/41 (48%), Gaps = 3/41 (7%) Frame = -2 Query: 138 TSTKPTGHIVSTQNTISTNYTTMSSIT---TRFCLHIVTRN 25 TST+ + T+S YTT S IT +C HIV N Sbjct: 511 TSTERVNELAIRNKTLSAGYTTTSCITHYNKGYCFHIVEIN 551
>sp|Q9DHR2|MP44_YLDV Probable metalloendopeptidase G1-type Length = 590 Score = 29.3 bits (64), Expect = 5.3 Identities = 16/67 (23%), Positives = 35/67 (52%) Frame = -2 Query: 204 SFSCTN*IIKNSTSNRSIN*NCTSTKPTGHIVSTQNTISTNYTTMSSITTRFCLHIVTRN 25 SF + + ST+ + ++ C S K + + + NT+ + + + + FCL+ + + Sbjct: 49 SFDSSKFVANASTARKYMSFWCCSIKGKSNYIDSINTLISWFFNNNKLRDNFCLNDIKNH 108 Query: 24 IDKQIEN 4 I K++EN Sbjct: 109 I-KELEN 114
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24,447,419 Number of Sequences: 369166 Number of extensions: 239011 Number of successful extensions: 507 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 478 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 504 length of database: 68,354,980 effective HSP length: 102 effective length of database: 49,512,010 effective search space used: 3069744620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)