Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_005_P06 (221 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q5DU02|UBP22_MOUSE Ubiquitin carboxyl-terminal hydrolase... 31 1.00 sp|Q9UPT9|UBP22_HUMAN Ubiquitin carboxyl-terminal hydrolase... 31 1.00 sp|Q6EW41|CEMA_NYMAL Chloroplast envelope membrane protein 30 1.7
>sp|Q5DU02|UBP22_MOUSE Ubiquitin carboxyl-terminal hydrolase 22 (Ubiquitin thiolesterase 22) (Ubiquitin-specific processing protease 22) (Deubiquitinating enzyme 22) Length = 525 Score = 30.8 bits (68), Expect = 1.00 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 3/40 (7%) Frame = -3 Query: 141 CELKNSSSL---KSSIRIVELYNGHLSPHIHFTMFHCTGT 31 CE+++ SS + S E Y+GH SPHI + + H T Sbjct: 211 CEMQSPSSCLVCEMSSLFQEFYSGHRSPHIPYKLLHLVWT 250
>sp|Q9UPT9|UBP22_HUMAN Ubiquitin carboxyl-terminal hydrolase 22 (Ubiquitin thiolesterase 22) (Ubiquitin-specific processing protease 22) (Deubiquitinating enzyme 22) Length = 525 Score = 30.8 bits (68), Expect = 1.00 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 3/40 (7%) Frame = -3 Query: 141 CELKNSSSL---KSSIRIVELYNGHLSPHIHFTMFHCTGT 31 CE+++ SS + S E Y+GH SPHI + + H T Sbjct: 211 CEMQSPSSCLVCEMSSLFQEFYSGHRSPHIPYKLLHLVWT 250
>sp|Q6EW41|CEMA_NYMAL Chloroplast envelope membrane protein Length = 229 Score = 30.0 bits (66), Expect = 1.7 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = -3 Query: 114 KSSIRIVELYNGHLSPHIHFTMFHCTGTTCYSVFPAYN 1 K +I++V ++N HIH + T TC+++ AY+ Sbjct: 90 KETIQLVRMHN---QDHIHIILHFSTNITCFAILSAYS 124
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21,683,451 Number of Sequences: 369166 Number of extensions: 265766 Number of successful extensions: 636 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 630 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 636 length of database: 68,354,980 effective HSP length: 45 effective length of database: 60,041,905 effective search space used: 1681173340 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)