Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_005_N03 (714 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P07983|GUN1_BACSU Endoglucanase precursor (Endo-1,4-beta... 30 4.9 sp|Q9VVN6|CP312_DROME Probable cytochrome P450 312a1 (CYPCC... 30 6.4 sp|P32949|LIP5_CANRU Lipase 5 precursor 30 8.4 sp|P16415|ZF36_HUMAN Zinc finger protein ZFP-36 30 8.4
>sp|P07983|GUN1_BACSU Endoglucanase precursor (Endo-1,4-beta-glucanase) (Cellulase) Length = 499 Score = 30.4 bits (67), Expect = 4.9 Identities = 28/90 (31%), Positives = 39/90 (43%), Gaps = 4/90 (4%) Frame = +1 Query: 37 QLHSCKSDGASIDLNPITAPVNFKDDQGNPWQYSPC--SEMVCGQ--DKSATSSLCKLYY 204 QLH + A++DL +TA + + N Q C ++M CG K T K Sbjct: 373 QLHIKNNGNATVDLKDVTA--RYWYNVKNKGQNFDCDYAQMGCGNLTHKFVTLHKPKQGA 430 Query: 205 SDYMEMGAFSTAKFIPDGPTLNIQYTANRD 294 Y+E+G F T P T NIQ + D Sbjct: 431 DTYLELG-FKTGTLSPGASTGNIQLRLHND 459
>sp|Q9VVN6|CP312_DROME Probable cytochrome P450 312a1 (CYPCCCXIIA1) Length = 510 Score = 30.0 bits (66), Expect = 6.4 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = +1 Query: 154 VCGQDKSATSSLCKLYYSDYMEMGAFSTAKFIPDGPTLNIQYTAN 288 VCG+DKS S+ ++ +++E T + P GP + TAN Sbjct: 349 VCGKDKSEPISIEQVRQLEFLEACIKETLRMYPSGPLTARKATAN 393
>sp|P32949|LIP5_CANRU Lipase 5 precursor Length = 549 Score = 29.6 bits (65), Expect = 8.4 Identities = 24/108 (22%), Positives = 37/108 (34%), Gaps = 15/108 (13%) Frame = +1 Query: 139 PCSEMVCGQDKSATSSLCKLYYSD---------YMEMGAFSTAKFIPDGPTLNIQYTANR 291 P + G+ + S LC L ++ G + +P P T Sbjct: 215 PSKVTIFGESAGSMSVLCHLLWNGGDNTYKGKPLFRAGIMQSGAMVPSDPVDGTYGTQIY 274 Query: 292 DSAFTST------MKLVCNENIDAQVDYIREASDNPGYLEYLQLQSKY 417 D+ ST KL C + Q + +D PG+L Y L+ Y Sbjct: 275 DTLVASTGCSSASNKLACLRGLSTQA-LLDATNDTPGFLSYTSLRLSY 321
>sp|P16415|ZF36_HUMAN Zinc finger protein ZFP-36 Length = 582 Score = 29.6 bits (65), Expect = 8.4 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = -2 Query: 494 NIINSTSPTLNPFFVGFTGFIVRKHAYLDCNWR 396 +I+N +P +NP G G +V H+ L+CN R Sbjct: 120 SIVNKNTPRVNPCDSGECGEVVLGHSSLNCNIR 152
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 89,185,746 Number of Sequences: 369166 Number of extensions: 1816446 Number of successful extensions: 4341 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4187 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4341 length of database: 68,354,980 effective HSP length: 107 effective length of database: 48,588,335 effective search space used: 6316483550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)