Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_005_L10 (317 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q8NEN9|PDZK8_HUMAN PDZ domain containing protein 8 (Sarc... 30 2.2 sp|Q7JLI1|NAS31_CAEEL Zinc metalloproteinase nas-31 precurs... 29 3.8 sp|Q73RJ6|SYC_TREDE Cysteinyl-tRNA synthetase (Cysteine--tR... 28 6.5
>sp|Q8NEN9|PDZK8_HUMAN PDZ domain containing protein 8 (Sarcoma antigen NY-SAR-84/NY-SAR-104) Length = 1154 Score = 29.6 bits (65), Expect = 2.2 Identities = 13/45 (28%), Positives = 23/45 (51%) Frame = +1 Query: 4 SFSDSQVEGSYRYRYCKSICKRHYNYCVNQCGFFEFFCKSRCKDR 138 SF D+Q + YCK K+ + +QC F + C +C+++ Sbjct: 842 SFQDTQFQNPTWCDYCK---KKVWTKAASQCMFCAYVCHKKCQEK 883
>sp|Q7JLI1|NAS31_CAEEL Zinc metalloproteinase nas-31 precursor (Nematode astacin 31) Length = 611 Score = 28.9 bits (63), Expect = 3.8 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +1 Query: 94 CGFFEFFCKSRCKDRYKSCKFTC 162 C F++FF R K +CKFTC Sbjct: 539 CDFYKFFGMCRSKKIRSNCKFTC 561
>sp|Q73RJ6|SYC_TREDE Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) Length = 492 Score = 28.1 bits (61), Expect = 6.5 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = -1 Query: 167 ILHVNLQDL*RSLHLDLQKNSKNPH 93 + ++NL+DL +++ KN +NPH Sbjct: 165 LANINLEDLKAGARIEIDKNKRNPH 189
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,649,016 Number of Sequences: 369166 Number of extensions: 466358 Number of successful extensions: 1038 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1005 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1038 length of database: 68,354,980 effective HSP length: 74 effective length of database: 54,684,590 effective search space used: 1695222290 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)