Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_005_J15 (395 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q7VKH9|RL31B_HAEDU 50S ribosomal protein L31 type B 33 0.27 sp|Q13118|KLF10_HUMAN Transforming growth factor-beta-induc... 30 1.7 sp|Q9P6S0|YJP1_SCHPO Hypothetical threonine-rich protein C1... 29 3.0 sp|Q51WZ9|ATG9_MAGGR Autophagy-related protein 9 29 3.9 sp|P58955|GR36A_DROME Putative gustatory receptor 36a 29 3.9 sp|P74178|Y1178_SYNY3 Hypothetical protein sll1178 28 5.1 sp|P56347|DNE1_CHLVU DNA endonuclease I-CvuI (23S rRNA intr... 28 5.1 sp|P79845|CRVP_TRIMU Cysteine-rich venom protein precursor ... 28 5.1 sp|Q8NGX0|O11L1_HUMAN Olfactory receptor 11L1 28 6.6 sp|Q6YR87|TILS_ONYPE tRNA(Ile)-lysidine synthase (tRNA(Ile)... 28 6.6
>sp|Q7VKH9|RL31B_HAEDU 50S ribosomal protein L31 type B Length = 89 Score = 32.7 bits (73), Expect = 0.27 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = -3 Query: 216 YSCSSNVQWFIRACVSSNNSIMW 148 Y S+ + W IR+CV++N S+MW Sbjct: 16 YDASAQMGWVIRSCVATNKSMMW 38
>sp|Q13118|KLF10_HUMAN Transforming growth factor-beta-inducible early growth response protein 1 (TGFB-inducible early growth response protein 1) (TIEG-1) (Krueppel-like factor 10) (EGRalpha) Length = 480 Score = 30.0 bits (66), Expect = 1.7 Identities = 18/59 (30%), Positives = 24/59 (40%) Frame = -1 Query: 179 LVCPPTTALCGTAPFPIHCQTYSFPQTRTPVSQSTSY*GILSSLPA*GKNPVECPTFVF 3 LV PP + G P P+ CQ P V+ ++ S P + P CP VF Sbjct: 256 LVSPPAVSAGGVPPMPVICQMVPLPANNPVVTT------VVPSTPP-SQPPAVCPPVVF 307
>sp|Q9P6S0|YJP1_SCHPO Hypothetical threonine-rich protein C1742.01 in chromosome III precursor Length = 1563 Score = 29.3 bits (64), Expect = 3.0 Identities = 20/57 (35%), Positives = 24/57 (42%), Gaps = 1/57 (1%) Frame = -1 Query: 242 TFPTHISPLTLARATYSGS*ELVC-PPTTALCGTAPFPIHCQTYSFPQTRTPVSQST 75 T T +P T+ T SGS C PPTT L T P T +P + T T Sbjct: 165 TTSTSCNPATVLIVTTSGSTSTSCPPPTTILIVTVPTTTTTTTVGYPGSVTTTLTGT 221
>sp|Q51WZ9|ATG9_MAGGR Autophagy-related protein 9 Length = 917 Score = 28.9 bits (63), Expect = 3.9 Identities = 17/62 (27%), Positives = 32/62 (51%), Gaps = 4/62 (6%) Frame = -2 Query: 175 CVLQQQHYVVLPHSPSIARHIHFPKHVLQYHKVPH---IEEYYL-LCQHKEKILWNVRLL 8 C++ Q+ + L ++ +A + F + YHK+PH +E+ + C ++WNV L Sbjct: 221 CIIVQR-ILELVNAAFVAVFLTFLSQCVDYHKLPHSKKMEDIIIPKCTQNMSLVWNVGLW 279 Query: 7 FF 2 F Sbjct: 280 LF 281
>sp|P58955|GR36A_DROME Putative gustatory receptor 36a Length = 391 Score = 28.9 bits (63), Expect = 3.9 Identities = 14/33 (42%), Positives = 22/33 (66%) Frame = -2 Query: 277 HMA*MHNYVKMLLFQRTYHHLLLLEQRTVVHKS 179 +MA +Y+ ++LF R Y+HLL E R +H+S Sbjct: 173 NMAISQHYL-VILFVRAYYHLLKTEVRQAIHES 204
>sp|P74178|Y1178_SYNY3 Hypothetical protein sll1178 Length = 615 Score = 28.5 bits (62), Expect = 5.1 Identities = 14/44 (31%), Positives = 18/44 (40%) Frame = +1 Query: 22 STGFFPYAGREDNIPQYEVLCDTGVRVWGNEYVWQWMGNGAVPH 153 ++ FFP + VLC GV W +W GN PH Sbjct: 139 ASAFFP-----SPFDEAAVLCMDGVGEWATTSLWSGQGNQLTPH 177
>sp|P56347|DNE1_CHLVU DNA endonuclease I-CvuI (23S rRNA intron protein) Length = 161 Score = 28.5 bits (62), Expect = 5.1 Identities = 13/38 (34%), Positives = 24/38 (63%), Gaps = 3/38 (7%) Frame = -3 Query: 111 ISPNTYSSITKYLIL---RNIIFSASIRKKSCGMSDFC 7 +S + S T++ IL + I+ ++RK++ GMS+FC Sbjct: 43 VSLTVFQSTTRHFILLDIQKILGCGTVRKRNDGMSEFC 80
>sp|P79845|CRVP_TRIMU Cysteine-rich venom protein precursor (TM-CRVP) Length = 240 Score = 28.5 bits (62), Expect = 5.1 Identities = 27/104 (25%), Positives = 38/104 (36%), Gaps = 19/104 (18%) Frame = +1 Query: 1 GKTKVGHSTGFFPYAGREDNIPQYEVLCDTGVRVWGNEYVWQWMGNGAVPHNAVVGGHT- 177 G K G + PY + +I + W EY G GAVP NA G +T Sbjct: 88 GGIKCGENIYMSPYPAKWTDI----------IHAWHGEYKDFKYGVGAVPSNAATGHYTQ 137 Query: 178 ------------------SSYEPLYVARARVSGDMCVGKVASSH 255 S Y YV + +G+M +GK A+ + Sbjct: 138 IVWYKSYRGGCAAAYCPSSKYRYFYVCQYCPAGNM-IGKTATPY 180
>sp|Q8NGX0|O11L1_HUMAN Olfactory receptor 11L1 Length = 322 Score = 28.1 bits (61), Expect = 6.6 Identities = 17/54 (31%), Positives = 28/54 (51%), Gaps = 9/54 (16%) Frame = -3 Query: 153 MWYCPIPHPLPDIFISPNTYSSITKYLI------LRNIIFSASIRK---KSCGM 19 M+ CP PH LP+I + + ++ L+ LRN F ++RK + CG+ Sbjct: 258 MYVCPSPHLLPEINKIISVFYTVVTPLLNPVIYSLRNKDFKEAVRKVMRRKCGI 311
>sp|Q6YR87|TILS_ONYPE tRNA(Ile)-lysidine synthase (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) Length = 436 Score = 28.1 bits (61), Expect = 6.6 Identities = 12/46 (26%), Positives = 27/46 (58%) Frame = -2 Query: 217 LLLLEQRTVVHKSLCVLQQQHYVVLPHSPSIARHIHFPKHVLQYHK 80 LLLLEQ+ + + + + P+ P+++ H++F H+++ +K Sbjct: 258 LLLLEQQNITKSFIFIQNIIKGINNPYKPNLSWHLNFEWHLIKDYK 303
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,203,471 Number of Sequences: 369166 Number of extensions: 1196345 Number of successful extensions: 3259 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 3180 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3253 length of database: 68,354,980 effective HSP length: 97 effective length of database: 50,435,685 effective search space used: 1714813290 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)