Planarian EST Database

Dr_sW_005_H04

BLASTX 2.2.12 [Aug-07-2005]

Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Dr_sW_005_H04
         (266 letters)

Database: Non-redundant SwissProt sequences 
           184,735 sequences; 68,354,980 total letters



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

sp|P83941|ELOC_RAT  Transcription elongation factor B polype...    84   1e-16

>sp|P83941|ELOC_RAT Transcription elongation factor B polypeptide 1 (RNA polymerase II
           transcription factor SIII subunit C) (SIII p15) (Elongin
           C) (EloC) (Elongin 15 kDa subunit) (Stromal
           membrane-associated protein SMAP1B homolog)
 sp|P83940|ELOC_MOUSE Transcription elongation factor B polypeptide 1 (RNA polymerase II
           transcription factor SIII subunit C) (SIII p15) (Elongin
           C) (EloC) (Elongin 15 kDa subunit) (Stromal
           membrane-associated protein SMAP1B homolog)
 sp|Q15369|ELOC_HUMAN Transcription elongation factor B polypeptide 1 (RNA polymerase II
           transcription factor SIII subunit C) (SIII p15) (Elongin
           C) (EloC) (Elongin 15 kDa subunit)
          Length = 112

 Score = 84.0 bits (206), Expect = 1e-16
 Identities = 38/45 (84%), Positives = 41/45 (91%)
 Frame = +2

Query: 2   HVIQKVCMYFAYKVKYTNSSTEIPEFQIPPEISLELLMAANFLDC 136
           HV+ KVCMYF YKV+YTNSSTEIPEF I PEI+LELLMAANFLDC
Sbjct: 68  HVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC 112

  Database: Non-redundant SwissProt sequences
    Posted date:  Dec 6, 2005  7:40 AM
  Number of letters in database: 68,354,980
  Number of sequences in database:  184,735
  
  Database: swissprot.01
    Posted date:  Dec 6, 2005  8:18 AM
  Number of letters in database: 66,202,850
  Number of sequences in database:  184,431
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 27,127,131
Number of Sequences: 369166
Number of extensions: 430409
Number of successful extensions: 918
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 906
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 918
length of database: 68,354,980
effective HSP length: 58
effective length of database: 57,640,350
effective search space used: 1729210500
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)