Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_004_M12 (549 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q9GHR6|MATK_PERAE Maturase K (Intron maturase) 30 3.0 sp|Q9GHM0|MATK_UMBCA Maturase K (Intron maturase) >gi|68052... 29 6.6
>sp|Q9GHR6|MATK_PERAE Maturase K (Intron maturase) Length = 507 Score = 30.4 bits (67), Expect = 3.0 Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 4/36 (11%) Frame = +3 Query: 441 TNRARLELHSKSNQ----LTSTSYIYYCDQIFIFIR 536 T++ + L SK NQ S S++Y C+ IFIF+R Sbjct: 194 TSKNSISLFSKENQRFFLFLSNSHVYECEFIFIFLR 229
>sp|Q9GHM0|MATK_UMBCA Maturase K (Intron maturase) sp|Q9GHV0|MATK_LINBE Maturase K (Intron maturase) Length = 507 Score = 29.3 bits (64), Expect = 6.6 Identities = 15/36 (41%), Positives = 21/36 (58%), Gaps = 4/36 (11%) Frame = +3 Query: 441 TNRARLELHSKSNQ----LTSTSYIYYCDQIFIFIR 536 T + + L SK NQ S S++Y C+ IFIF+R Sbjct: 194 TPKNSISLFSKENQRFFLFLSNSHVYECEFIFIFLR 229
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,456,047 Number of Sequences: 369166 Number of extensions: 896845 Number of successful extensions: 1970 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1910 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1970 length of database: 68,354,980 effective HSP length: 104 effective length of database: 49,142,540 effective search space used: 3833118120 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)