Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_004_C24 (446 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P62318|SMD3_HUMAN Small nuclear ribonucleoprotein Sm D3 ... 33 0.29 sp|O44437|SMD3_DROME Small nuclear ribonucleoprotein SM D3 ... 33 0.37 sp|Q9UUC6|SMD3_SCHPO Probable small nuclear ribonucleoprote... 29 5.4 sp|P43321|SMD3_YEAST Small nuclear ribonucleoprotein Sm D3 ... 28 9.2 sp|Q57007|Y1107_HAEIN Hypothetical Na(+)/H(+) antiporter HI... 28 9.2 sp|P07706|NU5M_DROYA NADH-ubiquinone oxidoreductase chain 5... 28 9.2
>sp|P62318|SMD3_HUMAN Small nuclear ribonucleoprotein Sm D3 (snRNP core protein D3) (Sm-D3) sp|P62320|SMD3_MOUSE Small nuclear ribonucleoprotein Sm D3 (snRNP core protein D3) (Sm-D3) sp|P62323|SMD3_XENLA Small nuclear ribonucleoprotein Sm D3 (snRNP core protein D3) (Sm-D3) Length = 126 Score = 33.1 bits (74), Expect = 0.29 Identities = 15/53 (28%), Positives = 30/53 (56%) Frame = +2 Query: 134 EVIKGTLIEVDKQIGIQLNDVNYKRTTNPKQKMKTVYIPWERIRFVKLPEKIE 292 EV +G LIE + + Q++++ +++ VYI +IRF+ LP+ ++ Sbjct: 26 EVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLK 78
>sp|O44437|SMD3_DROME Small nuclear ribonucleoprotein SM D3 (snRNP core protein D3) (SM-D3) Length = 151 Score = 32.7 bits (73), Expect = 0.37 Identities = 15/53 (28%), Positives = 27/53 (50%) Frame = +2 Query: 134 EVIKGTLIEVDKQIGIQLNDVNYKRTTNPKQKMKTVYIPWERIRFVKLPEKIE 292 EV +G LIE + + Q+ + ++ VYI +IRF+ LP+ ++ Sbjct: 26 EVYRGKLIEAEDNMNCQMTQITVTYRDGRTANLENVYIRGSKIRFLILPDMLK 78
>sp|Q9UUC6|SMD3_SCHPO Probable small nuclear ribonucleoprotein Sm D3 (snRNP core protein D3) (Sm-D3) Length = 97 Score = 28.9 bits (63), Expect = 5.4 Identities = 13/49 (26%), Positives = 24/49 (48%) Frame = +2 Query: 143 KGTLIEVDKQIGIQLNDVNYKRTTNPKQKMKTVYIPWERIRFVKLPEKI 289 +G LIE + + Q+ D++ + VYI IRF+ +P+ + Sbjct: 27 RGKLIEAEDNMNCQMRDISVTARDGRVSHLDQVYIRGSHIRFLIVPDML 75
>sp|P43321|SMD3_YEAST Small nuclear ribonucleoprotein Sm D3 (snRNP core protein D3) (Sm-D3) Length = 101 Score = 28.1 bits (61), Expect = 9.2 Identities = 11/50 (22%), Positives = 26/50 (52%) Frame = +2 Query: 143 KGTLIEVDKQIGIQLNDVNYKRTTNPKQKMKTVYIPWERIRFVKLPEKIE 292 +G L+E + + +QL DV M +++ +I+F+ +P+ ++ Sbjct: 30 RGKLVESEDSMNVQLRDVIATEPQGAVTHMDQIFVRGSQIKFIVVPDLLK 79
>sp|Q57007|Y1107_HAEIN Hypothetical Na(+)/H(+) antiporter HI1107 Length = 468 Score = 28.1 bits (61), Expect = 9.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -2 Query: 382 LSRLPWTFLCWCGRIRLLPFFAS 314 LS LPW LCW G I + + AS Sbjct: 437 LSYLPWAILCWSGIIFAIIYGAS 459
>sp|P07706|NU5M_DROYA NADH-ubiquinone oxidoreductase chain 5 (NADH dehydrogenase subunit 5) Length = 573 Score = 28.1 bits (61), Expect = 9.2 Identities = 8/25 (32%), Positives = 17/25 (68%) Frame = +3 Query: 33 CVLDFLNLVKLKMSCLIYSILY*MN 107 C + F+NL+ + ++C + S+ Y +N Sbjct: 2 CSISFINLISISLTCFLLSLYYLLN 26
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,924,931 Number of Sequences: 369166 Number of extensions: 746887 Number of successful extensions: 1947 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1940 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1947 length of database: 68,354,980 effective HSP length: 100 effective length of database: 49,881,480 effective search space used: 2394311040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)