Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_004_B02 (188 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q9BW19|KIFC1_HUMAN Kinesin-like protein KIFC1 (Kinesin-l... 64 1e-10 sp|P79955|CTK2_XENLA Carboxy-terminal kinesin 2 (XCTK2) 62 3e-10 sp|Q07970|ATK1_ARATH Kinesin-1 (Kinesin-like protein A) 57 2e-08 sp|P20480|NCD_DROME Claret segregational protein 56 2e-08 sp|P46864|ATK2_ARATH Kinesin-2 (Kinesin-like protein B) 55 6e-08 sp|P46875|ATK3_ARATH Kinesin-3 (Kinesin-like protein C) 55 6e-08 sp|O81635|ATK4_ARATH Kinesin-4 (Kinesin-like protein D) 54 1e-07 sp|Q86ZC1|KINH_BOTCI Kinesin heavy chain 52 5e-07 sp|P17119|KAR3_YEAST Kinesin-like protein KAR3 (Nuclear fus... 51 7e-07 sp|Q9UIL4|KIF25_HUMAN Kinesin-like protein KIF25 (Kinesin-l... 51 9e-07
>sp|Q9BW19|KIFC1_HUMAN Kinesin-like protein KIFC1 (Kinesin-like protein 2) (Kinesin-related protein HSET) Length = 673 Score = 63.9 bits (154), Expect = 1e-10 Identities = 31/54 (57%), Positives = 40/54 (74%) Frame = +1 Query: 1 SKLTHILEPSLGGDAKACLFVNISPDETNIQESLSSLQFGSNARQVALGQAKAN 162 SKLT++L+ SLGG AK +FVNISP E N+ ESL+SL+F S Q +G A+AN Sbjct: 618 SKLTYLLQNSLGGSAKMLMFVNISPLEENVSESLNSLRFASKVNQCVIGTAQAN 671
>sp|P79955|CTK2_XENLA Carboxy-terminal kinesin 2 (XCTK2) Length = 643 Score = 62.4 bits (150), Expect = 3e-10 Identities = 30/54 (55%), Positives = 40/54 (74%) Frame = +1 Query: 1 SKLTHILEPSLGGDAKACLFVNISPDETNIQESLSSLQFGSNARQVALGQAKAN 162 SKLT++L+ SLGG+AK +FVNISP E N ESL+SL+F S + +G A+AN Sbjct: 588 SKLTYLLQNSLGGNAKVLMFVNISPLEENFAESLNSLRFASKVNECVIGTARAN 641
>sp|Q07970|ATK1_ARATH Kinesin-1 (Kinesin-like protein A) Length = 793 Score = 56.6 bits (135), Expect = 2e-08 Identities = 26/49 (53%), Positives = 35/49 (71%) Frame = +1 Query: 1 SKLTHILEPSLGGDAKACLFVNISPDETNIQESLSSLQFGSNARQVALG 147 SKLT++L+P LGGD+K +FVNISPD T+ ESL SL+F + +G Sbjct: 727 SKLTYLLQPCLGGDSKTLMFVNISPDPTSAGESLCSLRFAARVNACEIG 775
>sp|P20480|NCD_DROME Claret segregational protein Length = 700 Score = 56.2 bits (134), Expect = 2e-08 Identities = 25/54 (46%), Positives = 38/54 (70%) Frame = +1 Query: 1 SKLTHILEPSLGGDAKACLFVNISPDETNIQESLSSLQFGSNARQVALGQAKAN 162 SKLTH+L PSLGG++K +F+N+SP + QES+ SL+F ++ + +AK N Sbjct: 625 SKLTHLLMPSLGGNSKTLMFINVSPFQDCFQESVKSLRFAASVNSCKMTKAKRN 678
>sp|P46864|ATK2_ARATH Kinesin-2 (Kinesin-like protein B) Length = 745 Score = 54.7 bits (130), Expect = 6e-08 Identities = 25/55 (45%), Positives = 38/55 (69%) Frame = +1 Query: 1 SKLTHILEPSLGGDAKACLFVNISPDETNIQESLSSLQFGSNARQVALGQAKANV 165 SKLT++L+P LGGD+K +FVNI+P+ ++ ESL SL+F + +G A +V Sbjct: 679 SKLTYLLQPCLGGDSKTLMFVNITPEPSSTGESLCSLRFAARVNACEIGTAHRHV 733
>sp|P46875|ATK3_ARATH Kinesin-3 (Kinesin-like protein C) Length = 754 Score = 54.7 bits (130), Expect = 6e-08 Identities = 26/58 (44%), Positives = 42/58 (72%), Gaps = 2/58 (3%) Frame = +1 Query: 1 SKLTHILEPSLGGDAKACLFVNISPDETNIQESLSSLQFGS--NARQVALGQAKANVQ 168 SKLT++L+P LGGDAK +FVNI+P+ ++ ESL SL+F + NA ++ + + N++ Sbjct: 688 SKLTYLLQPCLGGDAKTLMFVNIAPESSSTGESLCSLRFAARVNACEIGTPRRQTNIK 745
>sp|O81635|ATK4_ARATH Kinesin-4 (Kinesin-like protein D) Length = 987 Score = 53.5 bits (127), Expect = 1e-07 Identities = 25/54 (46%), Positives = 36/54 (66%) Frame = +1 Query: 1 SKLTHILEPSLGGDAKACLFVNISPDETNIQESLSSLQFGSNARQVALGQAKAN 162 SKLT +L+ SLGG AK +FV+ISP+ + E++S+L+F V LG A+ N Sbjct: 676 SKLTQLLQDSLGGSAKTLMFVHISPEPDTLGETISTLKFAERVGSVELGAARVN 729
>sp|Q86ZC1|KINH_BOTCI Kinesin heavy chain Length = 880 Score = 51.6 bits (122), Expect = 5e-07 Identities = 25/56 (44%), Positives = 38/56 (67%) Frame = +1 Query: 1 SKLTHILEPSLGGDAKACLFVNISPDETNIQESLSSLQFGSNARQVALGQAKANVQ 168 SKLT IL+ SLGG+++ L +N SP N +E+LS+L+FG A+ + +AK N + Sbjct: 282 SKLTRILQESLGGNSRTTLIINCSPSSYNAEETLSTLRFGMRAKAIK-NKAKVNAE 336
>sp|P17119|KAR3_YEAST Kinesin-like protein KAR3 (Nuclear fusion protein) Length = 729 Score = 51.2 bits (121), Expect = 7e-07 Identities = 25/52 (48%), Positives = 35/52 (67%) Frame = +1 Query: 1 SKLTHILEPSLGGDAKACLFVNISPDETNIQESLSSLQFGSNARQVALGQAK 156 SKLT++L+ SL GD+K +FVNISP ++I E+L+SL+F S L K Sbjct: 678 SKLTYLLQYSLTGDSKTLMFVNISPSSSHINETLNSLRFASKVNSTRLVSRK 729
>sp|Q9UIL4|KIF25_HUMAN Kinesin-like protein KIF25 (Kinesin-like protein 3) Length = 384 Score = 50.8 bits (120), Expect = 9e-07 Identities = 24/52 (46%), Positives = 35/52 (67%) Frame = +1 Query: 1 SKLTHILEPSLGGDAKACLFVNISPDETNIQESLSSLQFGSNARQVALGQAK 156 S+LTH+L+ LGGDAK + + ISP + ++ ++L L FG ARQV G A+ Sbjct: 318 SRLTHLLQDCLGGDAKLLVILCISPSQRHLAQTLQGLGFGIRARQVQRGPAR 369
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.310 0.125 0.336 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 19,958,863 Number of Sequences: 369166 Number of extensions: 268328 Number of successful extensions: 613 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 610 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 613 length of database: 68,354,980 effective HSP length: 35 effective length of database: 61,889,255 effective search space used: 1671009885 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits)