Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_004_A05 (235 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|O43852|CALU_HUMAN Calumenin precursor (Crocalbin) (IEF S... 73 2e-13 sp|O35887|CALU_MOUSE Calumenin precursor (Crocalbin) 73 2e-13 sp|O35783|CALU_RAT Calumenin precursor (Crocalbin) (CBP-50) 71 7e-13 sp|Q8BH97|RCN3_MOUSE Reticulocalbin-3 precursor 60 2e-09 sp|Q96D15|RCN3_HUMAN Reticulocalbin-3 precursor (EF-hand ca... 59 4e-09 sp|Q15293|RCN1_HUMAN Reticulocalbin-1 precursor 59 4e-09 sp|Q05186|RCN1_MOUSE Reticulocalbin-1 precursor 58 6e-09 sp|O93434|RCN1_FUGRU Reticulocalbin-1 precursor 57 1e-08 sp|Q62703|RCN2_RAT Reticulocalbin-2 precursor (Calcium-bind... 41 8e-04 sp|Q8BP92|RCN2_MOUSE Reticulocalbin-2 precursor (Taipoxin-a... 41 8e-04
>sp|O43852|CALU_HUMAN Calumenin precursor (Crocalbin) (IEF SSP 9302) Length = 315 Score = 73.2 bits (178), Expect = 2e-13 Identities = 33/50 (66%), Positives = 40/50 (80%) Frame = +1 Query: 1 HVTAETNHLMEQTDANKDGYLTKVEILEKYDVFVGSQATDFGDALTRHTE 150 H AE HL+ ++D NKDG LTK EI++KYD+FVGSQATDFG+AL RH E Sbjct: 265 HAEAEARHLVYESDQNKDGKLTKEEIVDKYDLFVGSQATDFGEALVRHDE 314
>sp|O35887|CALU_MOUSE Calumenin precursor (Crocalbin) Length = 315 Score = 73.2 bits (178), Expect = 2e-13 Identities = 33/50 (66%), Positives = 40/50 (80%) Frame = +1 Query: 1 HVTAETNHLMEQTDANKDGYLTKVEILEKYDVFVGSQATDFGDALTRHTE 150 H AE HL+ ++D NKDG LTK EI++KYD+FVGSQATDFG+AL RH E Sbjct: 265 HAEAEARHLVYESDQNKDGKLTKEEIVDKYDLFVGSQATDFGEALVRHDE 314
>sp|O35783|CALU_RAT Calumenin precursor (Crocalbin) (CBP-50) Length = 315 Score = 71.2 bits (173), Expect = 7e-13 Identities = 32/50 (64%), Positives = 40/50 (80%) Frame = +1 Query: 1 HVTAETNHLMEQTDANKDGYLTKVEILEKYDVFVGSQATDFGDALTRHTE 150 H AE HL+ ++D +KDG LTK EI++KYD+FVGSQATDFG+AL RH E Sbjct: 265 HAEAEARHLVYESDQDKDGKLTKEEIVDKYDLFVGSQATDFGEALVRHDE 314
>sp|Q8BH97|RCN3_MOUSE Reticulocalbin-3 precursor Length = 328 Score = 59.7 bits (143), Expect = 2e-09 Identities = 25/44 (56%), Positives = 36/44 (81%) Frame = +1 Query: 13 ETNHLMEQTDANKDGYLTKVEILEKYDVFVGSQATDFGDALTRH 144 E NHL+ ++D +KDG L+K EIL +++FVGSQAT++G+ LTRH Sbjct: 281 EANHLLHESDTDKDGRLSKAEILSNWNMFVGSQATNYGEDLTRH 324
>sp|Q96D15|RCN3_HUMAN Reticulocalbin-3 precursor (EF-hand calcium-binding protein RLP49) Length = 328 Score = 58.9 bits (141), Expect = 4e-09 Identities = 25/44 (56%), Positives = 36/44 (81%) Frame = +1 Query: 13 ETNHLMEQTDANKDGYLTKVEILEKYDVFVGSQATDFGDALTRH 144 E NHL+ ++D +KDG L+K EIL +++FVGSQAT++G+ LTRH Sbjct: 281 EANHLLHESDTDKDGRLSKAEILGNWNMFVGSQATNYGEDLTRH 324
>sp|Q15293|RCN1_HUMAN Reticulocalbin-1 precursor Length = 331 Score = 58.9 bits (141), Expect = 4e-09 Identities = 29/52 (55%), Positives = 39/52 (75%), Gaps = 1/52 (1%) Frame = +1 Query: 1 HVTAETNHLMEQTDANKDGYLTKVEILEKYDVFVGSQATDFGDALTR-HTEL 153 H AE HL+ ++D NKD LTK EILE +++FVGSQAT++G+ LT+ H EL Sbjct: 280 HAQAEARHLVYESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL 331
>sp|Q05186|RCN1_MOUSE Reticulocalbin-1 precursor Length = 325 Score = 58.2 bits (139), Expect = 6e-09 Identities = 28/52 (53%), Positives = 39/52 (75%), Gaps = 1/52 (1%) Frame = +1 Query: 1 HVTAETNHLMEQTDANKDGYLTKVEILEKYDVFVGSQATDFGDALTR-HTEL 153 H AE HL+ ++D NKD LTK EIL+ +++FVGSQAT++G+ LT+ H EL Sbjct: 274 HAQAEARHLVYESDKNKDEMLTKEEILDNWNMFVGSQATNYGEDLTKNHDEL 325
>sp|O93434|RCN1_FUGRU Reticulocalbin-1 precursor Length = 322 Score = 57.4 bits (137), Expect = 1e-08 Identities = 28/52 (53%), Positives = 39/52 (75%), Gaps = 1/52 (1%) Frame = +1 Query: 1 HVTAETNHLMEQTDANKDGYLTKVEILEKYDVFVGSQATDFGDALTR-HTEL 153 H AE HL+ ++D +KD LTK EIL+ +++FVGSQAT++G+ LTR H EL Sbjct: 271 HAQAEARHLVYESDKDKDQMLTKEEILDNWNMFVGSQATNYGEDLTRNHDEL 322
>sp|Q62703|RCN2_RAT Reticulocalbin-2 precursor (Calcium-binding protein ERC-55) (Taipoxin-associated calcium-binding protein 49) (TCBP-49) Length = 320 Score = 41.2 bits (95), Expect = 8e-04 Identities = 19/41 (46%), Positives = 28/41 (68%) Frame = +1 Query: 13 ETNHLMEQTDANKDGYLTKVEILEKYDVFVGSQATDFGDAL 135 E HL+++ D N D L++ EILE D+F+ S+ATD+G L Sbjct: 270 EALHLIDEMDLNSDKKLSEEEILENQDLFLTSEATDYGRQL 310
>sp|Q8BP92|RCN2_MOUSE Reticulocalbin-2 precursor (Taipoxin-associated calcium-binding protein 49) (TCBP-49) Length = 320 Score = 41.2 bits (95), Expect = 8e-04 Identities = 19/41 (46%), Positives = 28/41 (68%) Frame = +1 Query: 13 ETNHLMEQTDANKDGYLTKVEILEKYDVFVGSQATDFGDAL 135 E HL+++ D N D L++ EILE D+F+ S+ATD+G L Sbjct: 270 EALHLIDEMDLNSDKKLSEEEILENQDLFLTSEATDYGRQL 310
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,170,330 Number of Sequences: 369166 Number of extensions: 582369 Number of successful extensions: 1476 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1456 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1476 length of database: 68,354,980 effective HSP length: 48 effective length of database: 59,487,700 effective search space used: 1725143300 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)