Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_003_O22 (508 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q9H4Q3|PRD13_HUMAN PR-domain zinc finger protein 13 34 0.22 sp|Q43564|PRP1_MEDTR Repetitive proline-rich cell wall prot... 32 0.65 sp|Q7MXW0|GLYA_PORGI Serine hydroxymethyltransferase (Serin... 32 0.85 sp|Q40358|PRP_MEDSA Repetitive proline-rich cell wall prote... 32 0.85 sp|Q64U78|GLYA_BACFR Serine hydroxymethyltransferase (Serin... 30 2.5 sp|P19172|CHIA_ARATH Acidic endochitinase precursor 30 2.5 sp|Q6LU17|GLYA1_PHOPR Serine hydroxymethyltransferase 1 (Se... 30 2.5 sp|Q8A9S7|GLYA_BACTN Serine hydroxymethyltransferase (Serin... 30 2.5 sp|Q9R1D7|GBF1_CRIGR Golgi-specific brefeldin A-resistance ... 30 3.2 sp|Q40375|PRP2_MEDTR Repetitive proline-rich cell wall prot... 30 3.2
>sp|Q9H4Q3|PRD13_HUMAN PR-domain zinc finger protein 13 Length = 717 Score = 33.9 bits (76), Expect = 0.22 Identities = 26/73 (35%), Positives = 36/73 (49%), Gaps = 11/73 (15%) Frame = -3 Query: 404 CSAPPK---GIKAHP*-D*HTLPTLM*PFTIALPT*SGSLLLMQPPTTA-------FNGA 258 C+ PP G+KA+P + LP +M FT+ +G LL P TTA F G Sbjct: 444 CALPPLDPGGLKAYPGGECSHLPAVMPAFTVY----NGELLYGSPATTAYYPLKLHFGGL 499 Query: 257 CPFPQGIHAYSGP 219 +P+ I +SGP Sbjct: 500 LKYPESISYFSGP 512
>sp|Q43564|PRP1_MEDTR Repetitive proline-rich cell wall protein 1 precursor Length = 206 Score = 32.3 bits (72), Expect = 0.65 Identities = 19/60 (31%), Positives = 22/60 (36%) Frame = -3 Query: 248 PQGIHAYSGPKTCNPVSHKTXXXXXXXXLPPYGKNPVLCPEATLPIVTSFPVLALPINNP 69 PQG+ Y P P +K PP K PV P P V PV P+ P Sbjct: 18 PQGLANYEKPPVYQPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVYKPPVYKP 77
>sp|Q7MXW0|GLYA_PORGI Serine hydroxymethyltransferase (Serine methylase) (SHMT) Length = 426 Score = 32.0 bits (71), Expect = 0.85 Identities = 20/80 (25%), Positives = 34/80 (42%) Frame = +1 Query: 154 YGGREDNISNYEVLCDTGLHVFGPEYAWIPCGNGQAPLNAVVGGCINNNEPLYVGRAMVN 333 YGG E + ++ D ++G E+A + +G AV+ C+ + Sbjct: 57 YGGCEVVDQSEQIAIDRIKQLYGAEWANVQPHSGAQANMAVLLACLEAGDTFMGLNLEHG 116 Query: 334 GHMSVGKVCQSHGCAFMPFG 393 GH+S G + S G + P G Sbjct: 117 GHLSHGSLVNSSGILYRPIG 136
>sp|Q40358|PRP_MEDSA Repetitive proline-rich cell wall protein precursor (MSPRP) Length = 236 Score = 32.0 bits (71), Expect = 0.85 Identities = 19/60 (31%), Positives = 22/60 (36%) Frame = -3 Query: 248 PQGIHAYSGPKTCNPVSHKTXXXXXXXXLPPYGKNPVLCPEATLPIVTSFPVLALPINNP 69 PQG+ Y P P +K PP K PV P P V PV P+ P Sbjct: 18 PQGLANYDKPPVYQPPVYKPPVEKPPVYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVVKP 77
>sp|Q64U78|GLYA_BACFR Serine hydroxymethyltransferase (Serine methylase) (SHMT) Length = 426 Score = 30.4 bits (67), Expect = 2.5 Identities = 22/79 (27%), Positives = 38/79 (48%), Gaps = 1/79 (1%) Frame = +1 Query: 154 YGGREDNISNYEVLCDTGLHVFGPEYAWIPCGNGQAPLNAVVGGCINNNEPLYVGRAMVN 333 YGG E + ++ D +FG E+A + +G A NA V + N ++G + + Sbjct: 57 YGGCEVVDQSEQIAIDRLKEIFGAEWANVQPHSG-AQANAAVFLAVLNPGDKFMGLNLAH 115 Query: 334 G-HMSVGKVCQSHGCAFMP 387 G H+S G + + G + P Sbjct: 116 GGHLSHGSLVNTSGIIYTP 134
>sp|P19172|CHIA_ARATH Acidic endochitinase precursor Length = 302 Score = 30.4 bits (67), Expect = 2.5 Identities = 16/60 (26%), Positives = 24/60 (40%) Frame = +1 Query: 109 TIGKVASGHNTGFFPYGGREDNISNYEVLCDTGLHVFGPEYAWIPCGNGQAPLNAVVGGC 288 ++ K + G Y G+ N N C TG + + + GNGQ P + G C Sbjct: 20 SLSKPSDASRGGIAIYWGQNGNEGNLSATCATGRYAYVNVAFLVKFGNGQTPELNLAGHC 79
>sp|Q6LU17|GLYA1_PHOPR Serine hydroxymethyltransferase 1 (Serine methylase 1) (SHMT 1) Length = 416 Score = 30.4 bits (67), Expect = 2.5 Identities = 30/111 (27%), Positives = 46/111 (41%), Gaps = 2/111 (1%) Frame = +1 Query: 97 GNDVTIGKVASGHNTGFFPYGGREDNISNYEVLCDTGLHVFGPEYAWIPCGNGQAPLNAV 276 G+ +T K A G+ G YGG E ++ D +FG EYA + +G NAV Sbjct: 48 GSQLT-NKYAEGY-PGKRYYGGCEFVDKAEQLAIDRACQLFGAEYANVQPHSGSQANNAV 105 Query: 277 VGGCINNNEPLYVGRAMVNGHMSVGKVCQSHGCAF--MPFGGAEHKVYHYE 423 +N + + GH++ G G + +P+G E YE Sbjct: 106 YMALLNPGDTVLGMSLAHGGHLTHGSPVNFSGKLYNIIPYGIDETGQIDYE 156
>sp|Q8A9S7|GLYA_BACTN Serine hydroxymethyltransferase (Serine methylase) (SHMT) Length = 426 Score = 30.4 bits (67), Expect = 2.5 Identities = 22/79 (27%), Positives = 38/79 (48%), Gaps = 1/79 (1%) Frame = +1 Query: 154 YGGREDNISNYEVLCDTGLHVFGPEYAWIPCGNGQAPLNAVVGGCINNNEPLYVGRAMVN 333 YGG E + ++ D +FG E+A + +G A NA V + N ++G + + Sbjct: 57 YGGCEVVDQSEQIAIDRLKEIFGAEWANVQPHSG-AQANAAVFLAVLNPGDKFMGLNLAH 115 Query: 334 G-HMSVGKVCQSHGCAFMP 387 G H+S G + + G + P Sbjct: 116 GGHLSHGSLVNTSGIIYTP 134
>sp|Q9R1D7|GBF1_CRIGR Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1 (BFA-resistant GEF 1) Length = 1856 Score = 30.0 bits (66), Expect = 3.2 Identities = 22/75 (29%), Positives = 31/75 (41%), Gaps = 3/75 (4%) Frame = -3 Query: 293 LMQPPTTAFNGACPF--PQGIHAYSGPKTCNPV-SHKTXXXXXXXXLPPYGKNPVLCPEA 123 L P + GAC P+G A S +PV S + PP + P++ Sbjct: 1751 LPSPEIPSEVGACDSEKPEGTRATSSSSPGSPVASSPSRLSPSPEGPPPLAQPPLILQPL 1810 Query: 122 TLPIVTSFPVLALPI 78 T P+ P +ALPI Sbjct: 1811 TSPLQVGVPPMALPI 1825
>sp|Q40375|PRP2_MEDTR Repetitive proline-rich cell wall protein 2 precursor Length = 371 Score = 30.0 bits (66), Expect = 3.2 Identities = 18/60 (30%), Positives = 22/60 (36%) Frame = -3 Query: 248 PQGIHAYSGPKTCNPVSHKTXXXXXXXXLPPYGKNPVLCPEATLPIVTSFPVLALPINNP 69 P+G+ Y P P +K PP K PV P P V PV P+ P Sbjct: 18 PRGLANYDKPPVYQPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 77
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,442,518 Number of Sequences: 369166 Number of extensions: 1245196 Number of successful extensions: 3153 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 3003 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3151 length of database: 68,354,980 effective HSP length: 103 effective length of database: 49,327,275 effective search space used: 3206272875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)