Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.
Query= Dr_sW_003_L08
         (239 letters)
Database: Non-redundant SwissProt sequences 
           184,735 sequences; 68,354,980 total letters
                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value
sp|P20464|YTRE_LEPBI  Hypothetical 22 kDa protein in trpE 5'...    28   6.6  
sp|P39006|PSD1_YEAST  Phosphatidylserine decarboxylase proen...    28   8.6  
>sp|P20464|YTRE_LEPBI Hypothetical 22 kDa protein in trpE 5'region
          Length = 189
 Score = 28.1 bits (61), Expect = 6.6
 Identities = 11/17 (64%), Positives = 12/17 (70%), Gaps = 2/17 (11%)
 Frame = +3
Query: 84  IDAISRCRRCDGC--WE 128
           +DA   CRRCDGC  WE
Sbjct: 27  LDACLHCRRCDGCRIWE 43
>sp|P39006|PSD1_YEAST Phosphatidylserine decarboxylase proenzyme 1, mitochondrial
           precursor [Contains: Phosphatidylserine decarboxylase
           beta chain; Phosphatidylserine decarboxylase alpha
           chain]
          Length = 500
 Score = 27.7 bits (60), Expect = 8.6
 Identities = 14/34 (41%), Positives = 17/34 (50%)
 Frame = -1
Query: 137 RKHFPTAITPTAPTNGINPPNKLILNPSFLLFGS 36
           R+HFP  +   AP    N PN  +LN    L GS
Sbjct: 358 RRHFPGDLFSVAPYFQRNFPNLFVLNERVALLGS 391
  Database: Non-redundant SwissProt sequences
    Posted date:  Dec 6, 2005  7:40 AM
  Number of letters in database: 68,354,980
  Number of sequences in database:  184,735
  
  Database: swissprot.01
    Posted date:  Dec 6, 2005  8:18 AM
  Number of letters in database: 66,202,850
  Number of sequences in database:  184,431
  
Lambda     K      H
   0.318    0.134    0.401 
Gapped
Lambda     K      H
   0.267   0.0410    0.140 
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 25,493,782
Number of Sequences: 369166
Number of extensions: 413759
Number of successful extensions: 966
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 957
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 966
length of database: 68,354,980
effective HSP length: 50
effective length of database: 59,118,230
effective search space used: 1714428670
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)