Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_003_L08 (239 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P20464|YTRE_LEPBI Hypothetical 22 kDa protein in trpE 5'... 28 6.6 sp|P39006|PSD1_YEAST Phosphatidylserine decarboxylase proen... 28 8.6
>sp|P20464|YTRE_LEPBI Hypothetical 22 kDa protein in trpE 5'region Length = 189 Score = 28.1 bits (61), Expect = 6.6 Identities = 11/17 (64%), Positives = 12/17 (70%), Gaps = 2/17 (11%) Frame = +3 Query: 84 IDAISRCRRCDGC--WE 128 +DA CRRCDGC WE Sbjct: 27 LDACLHCRRCDGCRIWE 43
>sp|P39006|PSD1_YEAST Phosphatidylserine decarboxylase proenzyme 1, mitochondrial precursor [Contains: Phosphatidylserine decarboxylase beta chain; Phosphatidylserine decarboxylase alpha chain] Length = 500 Score = 27.7 bits (60), Expect = 8.6 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = -1 Query: 137 RKHFPTAITPTAPTNGINPPNKLILNPSFLLFGS 36 R+HFP + AP N PN +LN L GS Sbjct: 358 RRHFPGDLFSVAPYFQRNFPNLFVLNERVALLGS 391
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25,493,782 Number of Sequences: 369166 Number of extensions: 413759 Number of successful extensions: 966 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 957 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 966 length of database: 68,354,980 effective HSP length: 50 effective length of database: 59,118,230 effective search space used: 1714428670 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)