Planarian EST Database


Dr_sW_003_K17

BLASTX 2.2.12 [Aug-07-2005]

Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Dr_sW_003_K17
         (444 letters)

Database: Non-redundant SwissProt sequences 
           184,735 sequences; 68,354,980 total letters



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

sp|P15562|YMA6_PODAN  Hypothetical 34.3 kDa protein in ATP6 ...    28   6.9  
>sp|P15562|YMA6_PODAN Hypothetical 34.3 kDa protein in ATP6 5'region (ORFC)
          Length = 296

 Score = 28.5 bits (62), Expect = 6.9
 Identities = 16/58 (27%), Positives = 33/58 (56%)
 Frame = +1

Query: 112 IFIFVNLNIYFQ*NKYLFFNIVIYNFYTRTYLKILKVVNHGVTDLCQEIVSV*DRTTL 285
           + +++ LNI+   N  L+F IVI  F +   ++I  +++  +  + + I ++ DR TL
Sbjct: 77  LLLYLLLNIHISLNFVLYFRIVILGFISIKNMEISTLISF-IDYISEIIANIIDRNTL 133
  Database: Non-redundant SwissProt sequences
    Posted date:  Dec 6, 2005  7:40 AM
  Number of letters in database: 68,354,980
  Number of sequences in database:  184,735
  
  Database: swissprot.01
    Posted date:  Dec 6, 2005  8:18 AM
  Number of letters in database: 66,202,850
  Number of sequences in database:  184,431
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 34,304,310
Number of Sequences: 369166
Number of extensions: 519662
Number of successful extensions: 1257
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1246
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1256
length of database: 68,354,980
effective HSP length: 100
effective length of database: 49,881,480
effective search space used: 2344429560
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)