Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_003_J03 (161 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P52814|RL39_CAEEL 60S ribosomal protein L39 79 4e-15 sp|Q962S4|RL39_SPOFR 60S ribosomal protein L39 >gi|54036254... 76 3e-14 sp|Q90YS9|RL39_ICTPU 60S ribosomal protein L39 74 1e-13 sp|P62893|RL39_RAT 60S ribosomal protein L39 >gi|51702813|s... 74 1e-13 sp|Q98TF5|RL39_CHICK 60S ribosomal protein L39 74 1e-13 sp|O16130|RL39_DROME 60S ribosomal protein L39 (Ribosomal p... 73 2e-13 sp|Q6BHV8|RL39_DEBHA 60S ribosomal protein L39 72 3e-13 sp|P51425|RL39_MAIZE 60S ribosomal protein L39 >gi|55977802... 72 4e-13 sp|P51424|RL39_ARATH 60S ribosomal protein L39 72 5e-13 sp|P05767|RL39_SCHPO 60S ribosomal protein L39 (YL36) 70 2e-12
>sp|P52814|RL39_CAEEL 60S ribosomal protein L39 Length = 51 Score = 78.6 bits (192), Expect = 4e-15 Identities = 33/37 (89%), Positives = 37/37 (100%) Frame = +3 Query: 3 AKKQRQNRPIPQWVRLKTGNTIKYNAKRRHWRRTKLK 113 AKKQ+QNRP+PQWVR+KTGNT+KYNAKRRHWRRTKLK Sbjct: 14 AKKQKQNRPMPQWVRMKTGNTMKYNAKRRHWRRTKLK 50
>sp|Q962S4|RL39_SPOFR 60S ribosomal protein L39 sp|Q6F482|RL39_PLUXY 60S ribosomal protein L39 Length = 51 Score = 75.9 bits (185), Expect = 3e-14 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = +3 Query: 3 AKKQRQNRPIPQWVRLKTGNTIKYNAKRRHWRRTKLK 113 AKK +QNRPIPQWVR++TGNTI+YNAKRRHWRRTKLK Sbjct: 14 AKKLKQNRPIPQWVRMRTGNTIRYNAKRRHWRRTKLK 50
>sp|Q90YS9|RL39_ICTPU 60S ribosomal protein L39 Length = 51 Score = 73.9 bits (180), Expect = 1e-13 Identities = 30/36 (83%), Positives = 35/36 (97%) Frame = +3 Query: 3 AKKQRQNRPIPQWVRLKTGNTIKYNAKRRHWRRTKL 110 AKKQ+QNRPIPQW+R+KTGN I+YN+KRRHWRRTKL Sbjct: 14 AKKQKQNRPIPQWIRMKTGNKIRYNSKRRHWRRTKL 49
>sp|P62893|RL39_RAT 60S ribosomal protein L39 sp|P62892|RL39_MOUSE 60S ribosomal protein L39 sp|P62891|RL39_HUMAN 60S ribosomal protein L39 Length = 51 Score = 73.9 bits (180), Expect = 1e-13 Identities = 30/36 (83%), Positives = 35/36 (97%) Frame = +3 Query: 3 AKKQRQNRPIPQWVRLKTGNTIKYNAKRRHWRRTKL 110 AKKQ+QNRPIPQW+R+KTGN I+YN+KRRHWRRTKL Sbjct: 14 AKKQKQNRPIPQWIRMKTGNKIRYNSKRRHWRRTKL 49
>sp|Q98TF5|RL39_CHICK 60S ribosomal protein L39 Length = 51 Score = 73.9 bits (180), Expect = 1e-13 Identities = 30/36 (83%), Positives = 35/36 (97%) Frame = +3 Query: 3 AKKQRQNRPIPQWVRLKTGNTIKYNAKRRHWRRTKL 110 AKKQ+QNRPIPQW+R+KTGN I+YN+KRRHWRRTKL Sbjct: 14 AKKQKQNRPIPQWIRMKTGNKIRYNSKRRHWRRTKL 49
>sp|O16130|RL39_DROME 60S ribosomal protein L39 (Ribosomal protein 46) Length = 51 Score = 73.2 bits (178), Expect = 2e-13 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = +3 Query: 3 AKKQRQNRPIPQWVRLKTGNTIKYNAKRRHWRRTKLK 113 AKK +QNR +PQWVRL+TGNTI+YNAKRRHWRRTKLK Sbjct: 14 AKKLKQNRSVPQWVRLRTGNTIRYNAKRRHWRRTKLK 50
>sp|Q6BHV8|RL39_DEBHA 60S ribosomal protein L39 Length = 51 Score = 72.4 bits (176), Expect = 3e-13 Identities = 29/36 (80%), Positives = 35/36 (97%) Frame = +3 Query: 3 AKKQRQNRPIPQWVRLKTGNTIKYNAKRRHWRRTKL 110 AK Q+QNRP+PQW+RL++GNTI+YNAKRRHWRRTKL Sbjct: 14 AKAQKQNRPLPQWIRLRSGNTIRYNAKRRHWRRTKL 49
>sp|P51425|RL39_MAIZE 60S ribosomal protein L39 sp|P51426|RL39_ORYSA 60S ribosomal protein L39 Length = 51 Score = 72.0 bits (175), Expect = 4e-13 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = +3 Query: 3 AKKQRQNRPIPQWVRLKTGNTIKYNAKRRHWRRTKLKF 116 AKK RQNRPIP W+R++T NTI+YNAKRRHWRRTKL F Sbjct: 14 AKKMRQNRPIPYWIRMRTDNTIRYNAKRRHWRRTKLGF 51
>sp|P51424|RL39_ARATH 60S ribosomal protein L39 Length = 51 Score = 71.6 bits (174), Expect = 5e-13 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +3 Query: 6 KKQRQNRPIPQWVRLKTGNTIKYNAKRRHWRRTKLKF 116 KK RQNRPIP W+RL+T NTI+YNAKRRHWRRTKL F Sbjct: 15 KKMRQNRPIPHWIRLRTDNTIRYNAKRRHWRRTKLGF 51
>sp|P05767|RL39_SCHPO 60S ribosomal protein L39 (YL36) Length = 51 Score = 70.1 bits (170), Expect = 2e-12 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = +3 Query: 3 AKKQRQNRPIPQWVRLKTGNTIKYNAKRRHWRRTKL 110 AK RQNRPIPQW+RL+TGNT+ YN KRRHWRRTKL Sbjct: 14 AKAARQNRPIPQWIRLRTGNTVHYNMKRRHWRRTKL 49
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,539,788 Number of Sequences: 369166 Number of extensions: 248458 Number of successful extensions: 637 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 628 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 637 length of database: 68,354,980 effective HSP length: 26 effective length of database: 63,551,870 effective search space used: 1715900490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)