Planarian EST Database


Dr_sW_003_H20

BLASTX 2.2.12 [Aug-07-2005]

Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Dr_sW_003_H20
         (842 letters)

Database: Non-redundant SwissProt sequences 
           184,735 sequences; 68,354,980 total letters



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

sp|P41997|YKC6_CAEEL  Hypothetical protein B0280.6 in chromo...    54   5e-07
>sp|P41997|YKC6_CAEEL Hypothetical protein B0280.6 in chromosome III
          Length = 252

 Score = 53.9 bits (128), Expect = 5e-07
 Identities = 23/52 (44%), Positives = 33/52 (63%)
 Frame = -3

Query: 156 LLHDNNRLHTSKTTVYHLTSLGWKLLPHAAYSPGMAPSDYYLFRSLKHHLAD 1
           L+  + + H +K T   L  LGW +LPH  YSP +AP+DY+LF SL  ++ D
Sbjct: 152 LVTGDEKPHVAKKTFQKLQDLGWTVLPHPPYSPDLAPTDYHLFLSLSDYMRD 203
  Database: Non-redundant SwissProt sequences
    Posted date:  Dec 6, 2005  7:40 AM
  Number of letters in database: 68,354,980
  Number of sequences in database:  184,735
  
  Database: swissprot.01
    Posted date:  Dec 6, 2005  8:18 AM
  Number of letters in database: 66,202,850
  Number of sequences in database:  184,431
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 81,162,824
Number of Sequences: 369166
Number of extensions: 1521162
Number of successful extensions: 3220
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 3166
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3220
length of database: 68,354,980
effective HSP length: 109
effective length of database: 48,218,865
effective search space used: 8245425915
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)