Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_003_F10 (589 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q7VDC2|LGT_PROMA Prolipoprotein diacylglyceryl transferase 30 3.4 sp|P74374|RECN_SYNY3 DNA repair protein recN (Recombination... 29 7.6
>sp|Q7VDC2|LGT_PROMA Prolipoprotein diacylglyceryl transferase Length = 303 Score = 30.4 bits (67), Expect = 3.4 Identities = 12/35 (34%), Positives = 23/35 (65%) Frame = +1 Query: 358 LYFICIDICLMYLLMLDFRSVLLISNGKAACIFFI 462 L+ ICI + L++L L+ R ++ + +G +CI+ I Sbjct: 200 LWNICIFLILIFLFRLNIRGLMKLPSGALSCIYLI 234
>sp|P74374|RECN_SYNY3 DNA repair protein recN (Recombination protein N) Length = 584 Score = 29.3 bits (64), Expect = 7.6 Identities = 16/51 (31%), Positives = 31/51 (60%) Frame = -1 Query: 547 NLTNSITQEQVRLQHKYTKLTQNPCTKAQ*KKYMLPFHWKLVEHYGNLTLI 395 +LT +I ++ ++Q +Y +LT + AQ ++ + +L++H G LTLI Sbjct: 326 SLTEAIAYQE-KIQAEYDQLTDGEQSLAQLQESLTKAEQELIKHCGQLTLI 375
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,226,191 Number of Sequences: 369166 Number of extensions: 749709 Number of successful extensions: 2199 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2147 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2199 length of database: 68,354,980 effective HSP length: 105 effective length of database: 48,957,805 effective search space used: 4406202450 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)