Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_003_C08-2 (206 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q8N3Y1|FBXW8_HUMAN F-box/WD-repeat protein 8 (F-box and ... 32 0.59 sp|Q9UTI6|ECT1_SCHPO Probable ethanolamine-phosphate cytidy... 29 3.9
>sp|Q8N3Y1|FBXW8_HUMAN F-box/WD-repeat protein 8 (F-box and WD-40 domain protein 8) (F-box only protein 29) Length = 598 Score = 31.6 bits (70), Expect = 0.59 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -1 Query: 140 RLFTVENILSGIVCSSVSKRPPTIFVSGNPDSNL 39 RL + N+L C ++S PP + VSGN D + Sbjct: 424 RLLKLGNVLRDFTCVNLSDSPPNLMVSGNMDGRV 457
>sp|Q9UTI6|ECT1_SCHPO Probable ethanolamine-phosphate cytidylyltransferase (Phosphorylethanolamine transferase) (CTP:phosphoethanolamine cytidylyltransferase) Length = 365 Score = 28.9 bits (63), Expect = 3.9 Identities = 13/29 (44%), Positives = 21/29 (72%) Frame = +1 Query: 82 LLDTLEQTIPLNIFSTVKSLLNEILDLVK 168 LLD L ++PL I+ST S+L+ +DL++ Sbjct: 135 LLDRLLSSVPLEIYSTPVSVLSSQIDLLR 163
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.317 0.140 0.368 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 22,988,583 Number of Sequences: 369166 Number of extensions: 348557 Number of successful extensions: 1010 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1001 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1010 length of database: 68,354,980 effective HSP length: 40 effective length of database: 60,965,580 effective search space used: 1707036240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)