Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_002_P20 (521 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q96DT5|DYH11_HUMAN Ciliary dynein heavy chain 11 (Axonem... 31 2.0 sp|Q8NE79|POPD1_HUMAN Blood vessel epicardial substance (hB... 30 2.7 sp|Q9ES83|POPD1_MOUSE Blood vessel epicardial substance (Po... 29 6.0 sp|Q6FQJ2|ATG3_CANGA Autophagy-related protein 3 (Autophagy... 29 7.8
>sp|Q96DT5|DYH11_HUMAN Ciliary dynein heavy chain 11 (Axonemal beta dynein heavy chain 11) Length = 4523 Score = 30.8 bits (68), Expect = 2.0 Identities = 15/35 (42%), Positives = 22/35 (62%) Frame = -3 Query: 306 NPDTPRSFLAKVSETANILKINPNDESEKSYFIMN 202 N TP+SFL ++S N+LK N+ SEK ++N Sbjct: 3074 NYTTPKSFLEQISLFKNLLKKKQNEVSEKKERLVN 3108
>sp|Q8NE79|POPD1_HUMAN Blood vessel epicardial substance (hBVES) (Popeye domain containing protein 1) (Popeye protein 1) Length = 360 Score = 30.4 bits (67), Expect = 2.7 Identities = 21/56 (37%), Positives = 28/56 (50%) Frame = -3 Query: 507 SAERLVINNSKFLSEIPRYFIEDIFSFLIGKDGSRKIYTYIDVFRIQKKLNNTSYQ 340 S ERL FL P F+ +IF +LIGKD + K+Y+ D KK +Q Sbjct: 231 SRERLTY----FLESEP--FLYEIFRYLIGKDITNKLYSLNDPTLNDKKAKKLEHQ 280
>sp|Q9ES83|POPD1_MOUSE Blood vessel epicardial substance (Popeye domain containing protein 1) (Popeye protein 1) Length = 358 Score = 29.3 bits (64), Expect = 6.0 Identities = 21/56 (37%), Positives = 28/56 (50%) Frame = -3 Query: 507 SAERLVINNSKFLSEIPRYFIEDIFSFLIGKDGSRKIYTYIDVFRIQKKLNNTSYQ 340 S ERL FL P F+ +IF +LIGKD + K+Y+ D KK+ Q Sbjct: 231 SRERLTY----FLESEP--FLYEIFRYLIGKDITNKLYSLNDPTLNDKKVKKLEPQ 280
>sp|Q6FQJ2|ATG3_CANGA Autophagy-related protein 3 (Autophagy-related E2-like conjugation enzyme ATG3) Length = 309 Score = 28.9 bits (63), Expect = 7.8 Identities = 10/22 (45%), Positives = 17/22 (77%) Frame = -3 Query: 81 DNSMISNEDVSILKYYDAFITY 16 D+ +++N+ +L+YYD FITY Sbjct: 142 DDDIVANKTNEMLRYYDLFITY 163
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,449,063 Number of Sequences: 369166 Number of extensions: 826896 Number of successful extensions: 1623 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1608 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1623 length of database: 68,354,980 effective HSP length: 103 effective length of database: 49,327,275 effective search space used: 3452909250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)