Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_002_L06 (316 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q00143|VG39_ICHV1 Hypothetical gene 39 protein 30 1.7 sp|P48490|PP1_PHAVU Serine/threonine protein phosphatase PP1 29 3.8 sp|Q8TGB8|CUTI_MONFR Cutinase precursor (Cutin hydrolase) 29 3.8 sp|P38131|KTR4_YEAST Probable mannosyltransferase KTR4 28 5.0 sp|Q19005|YYT6_CAEEL Hypothetical protein D2096.6 in chromo... 28 6.5 sp|P22348|PUR6_METSM Probable phosphoribosylaminoimidazole ... 28 6.5 sp|Q10014|YR01_CAEEL Hypothetical protein T25E4.1 in chromo... 28 8.5
>sp|Q00143|VG39_ICHV1 Hypothetical gene 39 protein Length = 1123 Score = 30.0 bits (66), Expect = 1.7 Identities = 18/67 (26%), Positives = 29/67 (43%), Gaps = 15/67 (22%) Frame = -3 Query: 176 VSTRSKYLCVNQYLVVFNTYF---------------LSSMANKCSIKTGNNFSRYIFTV* 42 V+ K +CV Q L F L+SM ++ T NF+ +F V Sbjct: 693 VNNMPKSICVTQALTATENLFMNIAYAAILPIFTDTLASMGGGMTVDTETNFNGMVFPVY 752 Query: 41 KSSCYIG 21 +++C+IG Sbjct: 753 RNACFIG 759
>sp|P48490|PP1_PHAVU Serine/threonine protein phosphatase PP1 Length = 314 Score = 28.9 bits (63), Expect = 3.8 Identities = 18/43 (41%), Positives = 25/43 (58%), Gaps = 3/43 (6%) Frame = -2 Query: 180 LCIHQIQIFVCQPILGSFQHIFPV---LHGK*MQYQNREQLFQ 61 LC+H QIF+ QPIL + V +HG QYQ+ +LF+ Sbjct: 32 LCVHARQIFLSQPILLELRAPMRVCGDIHG---QYQDLLRLFE 71
>sp|Q8TGB8|CUTI_MONFR Cutinase precursor (Cutin hydrolase) Length = 201 Score = 28.9 bits (63), Expect = 3.8 Identities = 14/40 (35%), Positives = 18/40 (45%) Frame = +3 Query: 45 NGEYIPGKVVPGFDTAFICHGGQEICVENYQVLVDTQIFG 164 NG + G VP T ICH G IC +L+ +G Sbjct: 148 NGSPVQG--VPAAKTKIICHAGDNICQHGSMILMPHLTYG 185
>sp|P38131|KTR4_YEAST Probable mannosyltransferase KTR4 Length = 464 Score = 28.5 bits (62), Expect = 5.0 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -2 Query: 312 HEKVQIYPNLFYHQPLLFRYKVVF 241 H + Y FYH PLL +YK V+ Sbjct: 236 HNMCRFYSKEFYHHPLLSKYKYVW 259
>sp|Q19005|YYT6_CAEEL Hypothetical protein D2096.6 in chromosome IV Length = 171 Score = 28.1 bits (61), Expect = 6.5 Identities = 16/55 (29%), Positives = 22/55 (40%), Gaps = 5/55 (9%) Frame = -1 Query: 196 PVVCFPLYP----PDPNICVSTNTW*FSTHISCPPWQ-INAVSKPGTTFPGIYSP 47 P+ C P P P + C +TN+ + CP W A +P T F P Sbjct: 59 PIECDPKRPWPQCPPQSYCYATNSVDIGPYFCCPVWSTYGAAWRPATPFYNYVPP 113
>sp|P22348|PUR6_METSM Probable phosphoribosylaminoimidazole carboxylase (AIR carboxylase) (AIRC) Length = 339 Score = 28.1 bits (61), Expect = 6.5 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -3 Query: 92 CSIKTGNNFSRYIFTV*KSSCYIGITSSNS 3 C I++G F Y+ T+ + +IGI S++S Sbjct: 230 CPIRSGKKFRAYVNTMKNAKIFIGINSNSS 259
>sp|Q10014|YR01_CAEEL Hypothetical protein T25E4.1 in chromosome II precursor Length = 231 Score = 27.7 bits (60), Expect = 8.5 Identities = 16/55 (29%), Positives = 22/55 (40%), Gaps = 5/55 (9%) Frame = -1 Query: 196 PVVCFPLYP----PDPNICVSTNTW*FSTHISCPPWQ-INAVSKPGTTFPGIYSP 47 P+ C P P P + C +TN+ + CP W A +P T F P Sbjct: 118 PIECDPKRPWPQCPPQSYCYATNSVDIGPYFCCPIWSTYGAAWRPATPFYNYVPP 172
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,834,050 Number of Sequences: 369166 Number of extensions: 789902 Number of successful extensions: 1762 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1745 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1761 length of database: 68,354,980 effective HSP length: 73 effective length of database: 54,869,325 effective search space used: 1700949075 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)