Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_002_L02 (165 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P53634|CATC_HUMAN Dipeptidyl-peptidase I precursor (DPP-... 55 4e-08 sp|Q26563|CATC_SCHMA Cathepsin C precursor 52 3e-07 sp|O97578|CATC_CANFA Dipeptidyl-peptidase I precursor (DPP-... 51 7e-07 sp|Q60HG6|CATC_MACFA Dipeptidyl-peptidase I precursor (DPP-... 51 7e-07 sp|P97821|CATC_MOUSE Dipeptidyl-peptidase I precursor (DPP-... 50 1e-06 sp|P80067|CATC_RAT Dipeptidyl-peptidase I precursor (DPP-I)... 49 3e-06 sp|P25792|CYSP_SCHMA Cathepsin B-like cysteine proteinase p... 42 3e-04 sp|P43508|CPR4_CAEEL Cathepsin B-like cysteine proteinase 4... 42 3e-04 sp|P43510|CPR6_CAEEL Cathepsin B-like cysteine proteinase 6... 42 3e-04 sp|P07858|CATB_HUMAN Cathepsin B precursor (Cathepsin B1) (... 41 8e-04
>sp|P53634|CATC_HUMAN Dipeptidyl-peptidase I precursor (DPP-I) (DPPI) (Cathepsin C) (Cathepsin J) (Dipeptidyl transferase) [Contains: Dipeptidyl-peptidase I exclusion domain chain; Dipeptidyl-peptidase I heavy chain; Dipeptidyl-peptidase I light chain] Length = 463 Score = 55.5 bits (132), Expect = 4e-08 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = +2 Query: 2 GWGENGYFRIRRGNDECGIESLGVASEPI 88 GWGENGYFRIRRG DEC IES+ VA+ PI Sbjct: 432 GWGENGYFRIRRGTDECAIESIAVAATPI 460
>sp|Q26563|CATC_SCHMA Cathepsin C precursor Length = 454 Score = 52.4 bits (124), Expect = 3e-07 Identities = 21/29 (72%), Positives = 24/29 (82%) Frame = +2 Query: 5 WGENGYFRIRRGNDECGIESLGVASEPIL 91 WGE GYFRI RG DECG+ESLGV +P+L Sbjct: 426 WGEQGYFRILRGTDECGVESLGVRFDPVL 454
>sp|O97578|CATC_CANFA Dipeptidyl-peptidase I precursor (DPP-I) (DPPI) (Cathepsin C) (Cathepsin J) (Dipeptidyl transferase) [Contains: Dipeptidyl-peptidase I exclusion domain chain; Dipeptidyl-peptidase I heavy chain 1; Dipeptidyl-peptidase I heavy chain 2; Dipeptidyl-peptidase I heavy chain 3; Dipeptidyl-peptidase I heavy chain 4; Dipeptidyl-peptidase I light chain] Length = 435 Score = 51.2 bits (121), Expect = 7e-07 Identities = 21/28 (75%), Positives = 24/28 (85%) Frame = +2 Query: 5 WGENGYFRIRRGNDECGIESLGVASEPI 88 WGE+GYFRIRRG DEC IES+ VA+ PI Sbjct: 405 WGEDGYFRIRRGTDECAIESIAVAATPI 432
>sp|Q60HG6|CATC_MACFA Dipeptidyl-peptidase I precursor (DPP-I) (DPPI) (Cathepsin C) (Cathepsin J) (Dipeptidyl transferase) [Contains: Dipeptidyl-peptidase I exclusion domain chain; Dipeptidyl-peptidase I heavy chain; Dipeptidyl-peptidase I light chain] Length = 463 Score = 51.2 bits (121), Expect = 7e-07 Identities = 21/28 (75%), Positives = 24/28 (85%) Frame = +2 Query: 5 WGENGYFRIRRGNDECGIESLGVASEPI 88 WGE+GYFRIRRG DEC IES+ VA+ PI Sbjct: 433 WGEDGYFRIRRGTDECAIESIAVAATPI 460
>sp|P97821|CATC_MOUSE Dipeptidyl-peptidase I precursor (DPP-I) (DPPI) (Cathepsin C) (Cathepsin J) (Dipeptidyl transferase) [Contains: Dipeptidyl-peptidase I exclusion domain chain; Dipeptidyl-peptidase I heavy chain; Dipeptidyl-peptidase I light chain] Length = 462 Score = 50.4 bits (119), Expect = 1e-06 Identities = 21/28 (75%), Positives = 24/28 (85%) Frame = +2 Query: 5 WGENGYFRIRRGNDECGIESLGVASEPI 88 WGE+GYFRIRRG DEC IES+ VA+ PI Sbjct: 432 WGESGYFRIRRGTDECAIESIAVAAIPI 459
>sp|P80067|CATC_RAT Dipeptidyl-peptidase I precursor (DPP-I) (DPPI) (Cathepsin C) (Cathepsin J) (Dipeptidyl transferase) [Contains: Dipeptidyl-peptidase I exclusion domain chain; Dipeptidyl-peptidase I heavy chain; Dipeptidyl-peptidase I light chain] Length = 462 Score = 49.3 bits (116), Expect = 3e-06 Identities = 20/28 (71%), Positives = 24/28 (85%) Frame = +2 Query: 5 WGENGYFRIRRGNDECGIESLGVASEPI 88 WGE+GYFRIRRG DEC IES+ +A+ PI Sbjct: 432 WGESGYFRIRRGTDECAIESIAMAAIPI 459
>sp|P25792|CYSP_SCHMA Cathepsin B-like cysteine proteinase precursor (Antigen Sm31) Length = 340 Score = 42.4 bits (98), Expect = 3e-04 Identities = 18/24 (75%), Positives = 19/24 (79%) Frame = +2 Query: 5 WGENGYFRIRRGNDECGIESLGVA 76 WGENGYFRI RG DEC IES +A Sbjct: 313 WGENGYFRIVRGRDECSIESEVIA 336
>sp|P43508|CPR4_CAEEL Cathepsin B-like cysteine proteinase 4 precursor (Cysteine protease-related 4) Length = 335 Score = 42.4 bits (98), Expect = 3e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = +2 Query: 5 WGENGYFRIRRGNDECGIESLGVASEP 85 WGENGYFRI RG +ECGIE V P Sbjct: 307 WGENGYFRIIRGTNECGIEHAVVGGVP 333
>sp|P43510|CPR6_CAEEL Cathepsin B-like cysteine proteinase 6 precursor (Cysteine protease-related 6) Length = 379 Score = 42.4 bits (98), Expect = 3e-04 Identities = 21/33 (63%), Positives = 23/33 (69%) Frame = +2 Query: 5 WGENGYFRIRRGNDECGIESLGVASEPIL*MLT 103 WGE+G+FRI RG DECGIES V P L LT Sbjct: 331 WGEDGFFRILRGVDECGIESGVVGGIPKLNSLT 363
>sp|P07858|CATB_HUMAN Cathepsin B precursor (Cathepsin B1) (APP secretase) (APPS) [Contains: Cathepsin B light chain; Cathepsin B heavy chain] Length = 339 Score = 41.2 bits (95), Expect = 8e-04 Identities = 17/27 (62%), Positives = 20/27 (74%) Frame = +2 Query: 5 WGENGYFRIRRGNDECGIESLGVASEP 85 WG+NG+F+I RG D CGIES VA P Sbjct: 304 WGDNGFFKILRGQDHCGIESEVVAGIP 330
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,634,582 Number of Sequences: 369166 Number of extensions: 218417 Number of successful extensions: 628 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 627 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 628 length of database: 68,354,980 effective HSP length: 27 effective length of database: 63,367,135 effective search space used: 1710912645 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)