Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_002_J07 (706 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P79114|MYO10_BOVIN Myosin-10 (Myosin X) 30 6.2 sp|Q9HD67|MYO10_HUMAN Myosin-10 (Myosin X) 30 6.2 sp|O64459|UGPA_PYRPY UTP--glucose-1-phosphate uridylyltrans... 30 6.2
>sp|P79114|MYO10_BOVIN Myosin-10 (Myosin X) Length = 2052 Score = 30.0 bits (66), Expect = 6.2 Identities = 14/51 (27%), Positives = 27/51 (52%) Frame = +1 Query: 37 RLKHELASGDIQYQSKSGTVTPVELIYQSIPNFVKRNSLSSSMLEQVFKSN 189 +L +E Q+ + T P++ Q + +K N L+S ++EQ++K N Sbjct: 1474 KLLNEATRWSSAIQNVTDTKAPIDTPTQQLIQDIKENCLNSDVVEQIYKRN 1524
>sp|Q9HD67|MYO10_HUMAN Myosin-10 (Myosin X) Length = 2058 Score = 30.0 bits (66), Expect = 6.2 Identities = 14/51 (27%), Positives = 27/51 (52%) Frame = +1 Query: 37 RLKHELASGDIQYQSKSGTVTPVELIYQSIPNFVKRNSLSSSMLEQVFKSN 189 +L +E Q+ + T P++ Q + +K N L+S ++EQ++K N Sbjct: 1480 KLLNEATRWSSAIQNVTDTKAPIDTPTQQLIQDIKENCLNSDVVEQIYKRN 1530
>sp|O64459|UGPA_PYRPY UTP--glucose-1-phosphate uridylyltransferase (UDP-glucose pyrophosphorylase) (UDPGP) (UGPase) Length = 471 Score = 30.0 bits (66), Expect = 6.2 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = -1 Query: 628 NTDSIKCHLCSHWNINDNLNNSKILIINMYVNTETCQHIK 509 N D +K + S I++N N I +++ YV+ E QH++ Sbjct: 8 NVDKLKSDVASLSQISENEKNGFINLVSRYVSGEEAQHVE 47
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 68,168,800 Number of Sequences: 369166 Number of extensions: 1208947 Number of successful extensions: 2503 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2429 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2499 length of database: 68,354,980 effective HSP length: 107 effective length of database: 48,588,335 effective search space used: 6170718545 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)