Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_002_I21 (183 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q04693|RSE1_YEAST Pre-mRNA splicing factor RSE1 (RNA spl... 28 6.5 sp|Q9PR17|Y127_UREPA Hypothetical protein UU127 28 8.4
>sp|Q04693|RSE1_YEAST Pre-mRNA splicing factor RSE1 (RNA splicing and ER to Golgi transport factor 1) (Spliceosome associated protein 130) Length = 1361 Score = 28.1 bits (61), Expect = 6.5 Identities = 20/53 (37%), Positives = 23/53 (43%), Gaps = 7/53 (13%) Frame = -2 Query: 164 INCLQIVFKIVKHQPTDLYICGAHIRLLIFK-------LSQFIESLHQTNFIS 27 I+C+ Q L IC RLL +K LS IE LHQT IS Sbjct: 977 IDCVSAAIIDFTRQADHLIICAGDKRLLTYKILVNKDKLSFDIELLHQTEIIS 1029
>sp|Q9PR17|Y127_UREPA Hypothetical protein UU127 Length = 101 Score = 27.7 bits (60), Expect = 8.4 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = -2 Query: 158 CLQIVFKIVKHQPTDLYICGAHIRLLIFKLSQFIESLHQTNFISKSFD 15 C+ + F I+ D Y G +++ L F++ LHQ N I SF+ Sbjct: 14 CILLAFAIIFGIEIDYYHQGDYLKYL-----NFLDKLHQYNKIDNSFE 56
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 19,711,846 Number of Sequences: 369166 Number of extensions: 280503 Number of successful extensions: 548 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 544 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 546 length of database: 68,354,980 effective HSP length: 33 effective length of database: 62,258,725 effective search space used: 1680985575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)