Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_001_N10 (896 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P08603|CFAH_HUMAN Complement factor H precursor (H facto... 32 1.8 sp|Q9CHT2|GREA_LACLA Transcription elongation factor greA (... 32 3.1 sp|P33334|PRP8_YEAST Pre-mRNA splicing factor PRP8 31 4.1 sp|P62815|VATB2_RAT Vacuolar ATP synthase subunit B, brain ... 31 4.1 sp|P21281|VATB2_HUMAN Vacuolar ATP synthase subunit B, brai... 31 4.1 sp|P31408|VATB2_BOVIN Vacuolar ATP synthase subunit B, brai... 31 4.1 sp|P49712|VATB_CHICK Vacuolar ATP synthase subunit B (V-ATP... 30 7.0 sp|Q27896|TRF_DROME TBP-related factor 30 7.0 sp|Q09772|RDH54_SCHPO Meiotic recombination protein rdh54 (... 30 7.0 sp|P62000|TBP_PYRFU TATA-box binding protein (TATA-box fact... 30 9.1
>sp|P08603|CFAH_HUMAN Complement factor H precursor (H factor 1) Length = 1231 Score = 32.3 bits (72), Expect = 1.8 Identities = 16/40 (40%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = -1 Query: 866 RCSQYSCKDPDIINRLLI-QETLYKELSSHQKGVRL*YDY 750 +C + SCK PD+IN I Q+ +YKE Q + Y+Y Sbjct: 204 KCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEY 243
>sp|Q9CHT2|GREA_LACLA Transcription elongation factor greA (Transcript cleavage factor greA) Length = 156 Score = 31.6 bits (70), Expect = 3.1 Identities = 20/53 (37%), Positives = 28/53 (52%) Frame = +2 Query: 617 ADDEVHLGKNPTIASISLGSTRVFEICYRKDLYQGYNSKERNPFSSRIKDEPP 775 A DEV LGKN T + +G T ++ YQ + E +PFS +I +E P Sbjct: 82 AKDEVALGKNVTF--VEVGET-------DEESYQIVGTAEADPFSGKISNESP 125
>sp|P33334|PRP8_YEAST Pre-mRNA splicing factor PRP8 Length = 2413 Score = 31.2 bits (69), Expect = 4.1 Identities = 18/77 (23%), Positives = 36/77 (46%), Gaps = 4/77 (5%) Frame = +2 Query: 263 KDSLIDDLFYKMPSSINYMKEFLPPNKASELFRYFLQNLPWEQRENATPSG---QKFLEP 433 ++S++DD+ MP SI K SE +R + N+PW+ P +++++ Sbjct: 759 RNSVMDDILEMMPESIRQKKARTILQHLSEAWRCWKANIPWDVPGMPAPIKKIIERYIKS 818 Query: 434 RKTCWYGLP-YSYSKVK 481 + W Y+ ++K Sbjct: 819 KADAWVSAAHYNRERIK 835
>sp|P62815|VATB2_RAT Vacuolar ATP synthase subunit B, brain isoform (V-ATPase B2 subunit) (Vacuolar proton pump B isoform 2) (Endomembrane proton pump 58 kDa subunit) sp|P62814|VATB2_MOUSE Vacuolar ATP synthase subunit B, brain isoform (V-ATPase B2 subunit) (Vacuolar proton pump B isoform 2) (Endomembrane proton pump 58 kDa subunit) Length = 511 Score = 31.2 bits (69), Expect = 4.1 Identities = 19/68 (27%), Positives = 33/68 (48%) Frame = +3 Query: 678 QECLKFAIVKISTKVIIAKKETPSVVVSKTNPLLMAAQFFIECFLNQQPVDNVRIFTGIL 857 Q C + +VK S V+ +E ++V + + A+FF F +DNV +F + Sbjct: 205 QICRQAGLVKKSKDVVDYSEENFAIVFAAMGVNMETARFFKSDFEENGSMDNVCLFLNLA 264 Query: 858 AAPSSQRI 881 P+ +RI Sbjct: 265 NDPTIERI 272
>sp|P21281|VATB2_HUMAN Vacuolar ATP synthase subunit B, brain isoform (V-ATPase B2 subunit) (Vacuolar proton pump B isoform 2) (Endomembrane proton pump 58 kDa subunit) (HO57) Length = 511 Score = 31.2 bits (69), Expect = 4.1 Identities = 19/68 (27%), Positives = 33/68 (48%) Frame = +3 Query: 678 QECLKFAIVKISTKVIIAKKETPSVVVSKTNPLLMAAQFFIECFLNQQPVDNVRIFTGIL 857 Q C + +VK S V+ +E ++V + + A+FF F +DNV +F + Sbjct: 205 QICRQAGLVKKSKDVVDYSEENFAIVFAAMGVNMETARFFKSDFEENGSMDNVCLFLNLA 264 Query: 858 AAPSSQRI 881 P+ +RI Sbjct: 265 NDPTIERI 272
>sp|P31408|VATB2_BOVIN Vacuolar ATP synthase subunit B, brain isoform (V-ATPase B2 subunit) (Vacuolar proton pump B isoform 2) (Endomembrane proton pump 58 kDa subunit) Length = 511 Score = 31.2 bits (69), Expect = 4.1 Identities = 19/68 (27%), Positives = 33/68 (48%) Frame = +3 Query: 678 QECLKFAIVKISTKVIIAKKETPSVVVSKTNPLLMAAQFFIECFLNQQPVDNVRIFTGIL 857 Q C + +VK S V+ +E ++V + + A+FF F +DNV +F + Sbjct: 205 QICRQAGLVKKSKDVVDYSEENFAIVFAAMGVNMETARFFKSDFEQNGSMDNVCLFLNLA 264 Query: 858 AAPSSQRI 881 P+ +RI Sbjct: 265 NDPTIERI 272
>sp|P49712|VATB_CHICK Vacuolar ATP synthase subunit B (V-ATPase B subunit) (Vacuolar proton pump B subunit) Length = 453 Score = 30.4 bits (67), Expect = 7.0 Identities = 19/68 (27%), Positives = 33/68 (48%) Frame = +3 Query: 678 QECLKFAIVKISTKVIIAKKETPSVVVSKTNPLLMAAQFFIECFLNQQPVDNVRIFTGIL 857 Q C + +VK S V+ +E ++V + + A+FF F +DNV +F + Sbjct: 146 QICRQAGLVKKSKDVMDYSEENFAIVFAAMGVNMETARFFKSDFEENGSMDNVCLFLNLA 205 Query: 858 AAPSSQRI 881 P+ +RI Sbjct: 206 NDPTIERI 213
>sp|Q27896|TRF_DROME TBP-related factor Length = 224 Score = 30.4 bits (67), Expect = 7.0 Identities = 17/61 (27%), Positives = 31/61 (50%) Frame = +3 Query: 321 KNFYHPIKLQNFSAIFSKICHGNSEKMLLLVVKSFWNPERHVGMVCHIHIRK*KCLLTKI 500 K+ H I+LQN A FS C + + + S ++P+R G++ +H + L+ + Sbjct: 43 KDAQHEIRLQNIVATFSVNCELDLKAINSRTRNSEYSPKRFRGVIMRMHSPRCTALIFRT 102 Query: 501 G 503 G Sbjct: 103 G 103
>sp|Q09772|RDH54_SCHPO Meiotic recombination protein rdh54 (RAD54 protein homolog 2) Length = 811 Score = 30.4 bits (67), Expect = 7.0 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = -3 Query: 567 LLKGLPFENDWTEFIKSFNSVSQFSLGGIFTFEYEYGKP 451 LL G P +ND +E+ N + SLG +F+ +Y +P Sbjct: 368 LLTGTPLQNDLSEYFSMVNFIIPGSLGTPNSFKAQYERP 406
>sp|P62000|TBP_PYRFU TATA-box binding protein (TATA-box factor) (TATA sequence-binding protein) (TBP) (Box A binding protein) (BAP) sp|P62001|TBP_PYRWO TATA-box binding protein (TATA-box factor) (TATA sequence-binding protein) (TBP) (Box A binding protein) (BAP) Length = 191 Score = 30.0 bits (66), Expect = 9.1 Identities = 16/55 (29%), Positives = 27/55 (49%) Frame = +3 Query: 339 IKLQNFSAIFSKICHGNSEKMLLLVVKSFWNPERHVGMVCHIHIRK*KCLLTKIG 503 ++++N A + EK+L L S +NPE G++CH+ K L+ G Sbjct: 9 LRIENIVASVDLFAQLDLEKVLDLCPNSKYNPEEFPGIICHLDDPKVALLIFSSG 63
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 101,069,832 Number of Sequences: 369166 Number of extensions: 2103472 Number of successful extensions: 5201 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 5008 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5200 length of database: 68,354,980 effective HSP length: 110 effective length of database: 48,034,130 effective search space used: 9030416440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)