Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_001_K20 (455 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P41997|YKC6_CAEEL Hypothetical protein B0280.6 in chromo... 31 1.5 sp|Q6PSC6|MATK_PHAVU Maturase K (Intron maturase) 30 1.9 sp|Q9BBP4|CCSA_LOTJA Cytochrome c biogenesis protein ccsA 30 3.3 sp|Q6ENA8|CCSA_ORYNI Cytochrome c biogenesis protein ccsA 29 4.3 sp|P46659|CCSA_MAIZE CYTOCHROME C BIOGENESIS PROTEIN CCSA 29 4.3 sp|P12216|CCSA_TOBAC Cytochrome c biogenesis protein ccsA 29 4.3 sp|P12215|CCSA_ORYSA Cytochrome c biogenesis protein ccsA 29 4.3 sp|Q9MTI2|CCSA_OENHO Cytochrome c biogenesis protein ccsA 29 5.6 sp|Q8TWY1|SYA_METKA Alanyl-tRNA synthetase (Alanine--tRNA l... 28 7.3
>sp|P41997|YKC6_CAEEL Hypothetical protein B0280.6 in chromosome III Length = 252 Score = 30.8 bits (68), Expect = 1.5 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = -2 Query: 79 YSPDLAPSDFFLFRKLKKYL 20 YSPDLAP+D+ LF L Y+ Sbjct: 182 YSPDLAPTDYHLFLSLSDYM 201
>sp|Q6PSC6|MATK_PHAVU Maturase K (Intron maturase) Length = 513 Score = 30.4 bits (67), Expect = 1.9 Identities = 22/85 (25%), Positives = 41/85 (48%), Gaps = 4/85 (4%) Frame = -2 Query: 262 LHIVL*FFSNLRPRLDYLDHSSI----FPLFLECLIN*SSIFVRNVHVRRGKKFFHHDNA 95 +H + FF + +L YL+H S +P+ LE L+ ++++V +FF + + Sbjct: 127 IHSIFPFFED---KLIYLNHKSDIRIPYPIHLEILVQILGYWIKDVSFFHVIRFFFYYYS 183 Query: 94 PAQTSYSPDLAPSDFFLFRKLKKYL 20 + + P S FF R L+ +L Sbjct: 184 NWNSLFPPKKGISTFFSKRNLRIFL 208
>sp|Q9BBP4|CCSA_LOTJA Cytochrome c biogenesis protein ccsA Length = 323 Score = 29.6 bits (65), Expect = 3.3 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +3 Query: 102 SWWKNFFPRRTWTFLTNMLDQFIKHSRNNGNIE 200 S+W N+ P+ TW F+T + HSR N +E Sbjct: 254 SYW-NWDPKETWAFITWTIFAIYLHSRKNKKLE 285
>sp|Q6ENA8|CCSA_ORYNI Cytochrome c biogenesis protein ccsA Length = 321 Score = 29.3 bits (64), Expect = 4.3 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 102 SWWKNFFPRRTWTFLTNMLDQFIKHSRNNGN 194 S+W N+ P+ TW F+T + HSR N N Sbjct: 251 SYW-NWDPKETWAFITWTIFAIYLHSRTNPN 280
>sp|P46659|CCSA_MAIZE CYTOCHROME C BIOGENESIS PROTEIN CCSA Length = 321 Score = 29.3 bits (64), Expect = 4.3 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 102 SWWKNFFPRRTWTFLTNMLDQFIKHSRNNGN 194 S+W N+ P+ TW F+T + HSR N N Sbjct: 250 SYW-NWDPKETWAFITWTIFAIYLHSRKNPN 279
>sp|P12216|CCSA_TOBAC Cytochrome c biogenesis protein ccsA Length = 313 Score = 29.3 bits (64), Expect = 4.3 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +3 Query: 102 SWWKNFFPRRTWTFLTNMLDQFIKHSRNNGNI 197 S+W N+ P+ TW F+T ++ H+R N N+ Sbjct: 242 SYW-NWDPKETWAFITWIVFAIYLHTRTNRNL 272
>sp|P12215|CCSA_ORYSA Cytochrome c biogenesis protein ccsA Length = 321 Score = 29.3 bits (64), Expect = 4.3 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 102 SWWKNFFPRRTWTFLTNMLDQFIKHSRNNGN 194 S+W N+ P+ TW F+T + HSR N N Sbjct: 251 SYW-NWDPKETWAFITWTIFAIYLHSRTNPN 280
>sp|Q9MTI2|CCSA_OENHO Cytochrome c biogenesis protein ccsA Length = 319 Score = 28.9 bits (63), Expect = 5.6 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +3 Query: 102 SWWKNFFPRRTWTFLTNMLDQFIKHSRNNGNIE 200 S+W N+ P+ TW F+T + H+R N N + Sbjct: 250 SYW-NWDPKETWAFITWTMFAIYLHTRTNPNFQ 281
>sp|Q8TWY1|SYA_METKA Alanyl-tRNA synthetase (Alanine--tRNA ligase) (AlaRS) Length = 915 Score = 28.5 bits (62), Expect = 7.3 Identities = 21/66 (31%), Positives = 32/66 (48%), Gaps = 5/66 (7%) Frame = +1 Query: 112 KIFFLDGHGRFSRICWISLSSIQGTTEILKNGPDNLDEVV-----NWKKIIKRYVTIRNI 276 +I F G RI W + ++ T E+L+ P+NL + V WK+ KR I + Sbjct: 737 RIRFAAGEAALERI-WETEDLLRETCEVLRVNPENLPKTVKRFFEEWKEQRKR---IERL 792 Query: 277 EEESVQ 294 E E V+ Sbjct: 793 ERELVE 798
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,997,751 Number of Sequences: 369166 Number of extensions: 1084604 Number of successful extensions: 2723 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 2654 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2723 length of database: 68,354,980 effective HSP length: 101 effective length of database: 49,696,745 effective search space used: 2484837250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)