Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_001_K06 (714 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q8C2Q3|RBM14_MOUSE RNA-binding protein 14 (RNA-binding m... 35 0.26 sp|Q5RC41|RBM14_PONPY RNA-binding protein 14 (RNA-binding m... 35 0.26 sp|Q96PK6|RBM14_HUMAN RNA-binding protein 14 (RNA-binding m... 35 0.26 sp|Q5EA36|RBM14_BOVIN RNA-binding protein 14 (RNA-binding m... 35 0.26 sp|Q8VE92|RBM30_MOUSE RNA-binding protein 30 (RNA-binding m... 33 0.58 sp|Q9BQ04|RBM30_HUMAN RNA-binding protein 30 (RNA-binding m... 33 0.58 sp|Q9BWF3|RBM4_HUMAN RNA-binding protein 4 (RNA-binding mot... 33 0.58 sp|Q64LC9|RBM30_RAT RNA-binding protein 30 (RNA-binding mot... 33 0.58 sp|Q8C7Q4|RBM4_MOUSE RNA-binding protein 4 (RNA-binding mot... 33 0.58 sp|Q9BDY9|RBM4_RABIT RNA-binding protein 4 (RNA-binding mot... 33 0.58
>sp|Q8C2Q3|RBM14_MOUSE RNA-binding protein 14 (RNA-binding motif protein 14) Length = 669 Score = 34.7 bits (78), Expect = 0.26 Identities = 17/35 (48%), Positives = 21/35 (60%) Frame = +2 Query: 2 FIHMSSEEEANHAIEVLDGTEFAGNIINVEISHGG 106 F+HM E +A AI L+G E G INVE+S G Sbjct: 116 FVHMEKEADAKAAIAQLNGKEVKGKRINVELSTKG 150
>sp|Q5RC41|RBM14_PONPY RNA-binding protein 14 (RNA-binding motif protein 14) Length = 669 Score = 34.7 bits (78), Expect = 0.26 Identities = 17/35 (48%), Positives = 21/35 (60%) Frame = +2 Query: 2 FIHMSSEEEANHAIEVLDGTEFAGNIINVEISHGG 106 F+HM E +A AI L+G E G INVE+S G Sbjct: 116 FVHMEKEADAKAAIAQLNGKEVKGKRINVELSTKG 150
>sp|Q96PK6|RBM14_HUMAN RNA-binding protein 14 (RNA-binding motif protein 14) (RRM-containing coactivator activator/modulator) (Synaptotagmin-interacting protein) (SYT-interacting protein) Length = 669 Score = 34.7 bits (78), Expect = 0.26 Identities = 17/35 (48%), Positives = 21/35 (60%) Frame = +2 Query: 2 FIHMSSEEEANHAIEVLDGTEFAGNIINVEISHGG 106 F+HM E +A AI L+G E G INVE+S G Sbjct: 116 FVHMEKEADAKAAIAQLNGKEVKGKRINVELSTKG 150
>sp|Q5EA36|RBM14_BOVIN RNA-binding protein 14 (RNA-binding motif protein 14) Length = 669 Score = 34.7 bits (78), Expect = 0.26 Identities = 17/35 (48%), Positives = 21/35 (60%) Frame = +2 Query: 2 FIHMSSEEEANHAIEVLDGTEFAGNIINVEISHGG 106 F+HM E +A AI L+G E G INVE+S G Sbjct: 116 FVHMEKEADAKAAIAQLNGKEVKGKRINVELSTKG 150
>sp|Q8VE92|RBM30_MOUSE RNA-binding protein 30 (RNA-binding motif protein 30) Length = 357 Score = 33.5 bits (75), Expect = 0.58 Identities = 15/32 (46%), Positives = 21/32 (65%) Frame = +2 Query: 2 FIHMSSEEEANHAIEVLDGTEFAGNIINVEIS 97 F+HM E+A AI LD TEF G ++V++S Sbjct: 115 FVHMERAEDAVEAIRGLDNTEFQGKRMHVQLS 146
>sp|Q9BQ04|RBM30_HUMAN RNA-binding protein 30 (RNA-binding motif protein 30) (RNA-binding motif protein 4b) Length = 359 Score = 33.5 bits (75), Expect = 0.58 Identities = 15/32 (46%), Positives = 21/32 (65%) Frame = +2 Query: 2 FIHMSSEEEANHAIEVLDGTEFAGNIINVEIS 97 F+HM E+A AI LD TEF G ++V++S Sbjct: 115 FVHMERAEDAVEAIRGLDNTEFQGKRMHVQLS 146
>sp|Q9BWF3|RBM4_HUMAN RNA-binding protein 4 (RNA-binding motif protein 4) (Lark homolog) (Hlark) (RNA-binding motif protein 4a) Length = 364 Score = 33.5 bits (75), Expect = 0.58 Identities = 15/32 (46%), Positives = 21/32 (65%) Frame = +2 Query: 2 FIHMSSEEEANHAIEVLDGTEFAGNIINVEIS 97 F+HM E+A AI LD TEF G ++V++S Sbjct: 115 FVHMERAEDAVEAIRGLDNTEFQGKRMHVQLS 146
>sp|Q64LC9|RBM30_RAT RNA-binding protein 30 (RNA-binding motif protein 30) (Zinc-responsive protein ZD7) Length = 357 Score = 33.5 bits (75), Expect = 0.58 Identities = 15/32 (46%), Positives = 21/32 (65%) Frame = +2 Query: 2 FIHMSSEEEANHAIEVLDGTEFAGNIINVEIS 97 F+HM E+A AI LD TEF G ++V++S Sbjct: 115 FVHMERAEDAVEAIRGLDNTEFQGKRMHVQLS 146
>sp|Q8C7Q4|RBM4_MOUSE RNA-binding protein 4 (RNA-binding motif protein 4) (Lark homolog) (Mlark) Length = 361 Score = 33.5 bits (75), Expect = 0.58 Identities = 15/32 (46%), Positives = 21/32 (65%) Frame = +2 Query: 2 FIHMSSEEEANHAIEVLDGTEFAGNIINVEIS 97 F+HM E+A AI LD TEF G ++V++S Sbjct: 115 FVHMERAEDAVEAIRGLDNTEFQGKRMHVQLS 146
>sp|Q9BDY9|RBM4_RABIT RNA-binding protein 4 (RNA-binding motif protein 4) (Lark homolog) Length = 359 Score = 33.5 bits (75), Expect = 0.58 Identities = 15/32 (46%), Positives = 21/32 (65%) Frame = +2 Query: 2 FIHMSSEEEANHAIEVLDGTEFAGNIINVEIS 97 F+HM E+A AI LD TEF G ++V++S Sbjct: 115 FVHMERAEDAVEAIRGLDNTEFQGKRMHVQLS 146
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 70,509,074 Number of Sequences: 369166 Number of extensions: 1250022 Number of successful extensions: 3374 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 3277 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3372 length of database: 68,354,980 effective HSP length: 107 effective length of database: 48,588,335 effective search space used: 6316483550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)