Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_001_J21 (378 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q05856|RSMB_DROME Small nuclear ribonucleoprotein associ... 37 0.011 sp|P91918|RSMB_CAEEL Probable small nuclear ribonucleoprote... 37 0.014 sp|P14678|RSMB_HUMAN Small nuclear ribonucleoprotein associ... 33 0.20 sp|P27048|RSMB_MOUSE Small nuclear ribonucleoprotein associ... 33 0.20 sp|P63162|RSMN_HUMAN Small nuclear ribonucleoprotein associ... 33 0.20 sp|Q9PV94|RSMB_CHICK Small nuclear ribonucleoprotein associ... 33 0.20 sp|Q9TU66|RSMB_MONDO Small nuclear ribonucleoprotein associ... 33 0.20 sp|P40582|GST1_YEAST Glutathione S-transferase I (GST-I) 33 0.20 sp|Q9TU67|RSMB_ERIEU Small nuclear ribonucleoprotein associ... 33 0.20 sp|P17136|RSMB_RAT Small nuclear ribonucleoprotein associat... 33 0.20
>sp|Q05856|RSMB_DROME Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) Length = 199 Score = 37.4 bits (85), Expect = 0.011 Identities = 15/22 (68%), Positives = 19/22 (86%) Frame = +1 Query: 1 FVLIRGEQLVSLNVDGPPPTED 66 FVL+RGE +VSL V+GPPP E+ Sbjct: 69 FVLLRGENIVSLTVEGPPPPEE 90
>sp|P91918|RSMB_CAEEL Probable small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) Length = 160 Score = 37.0 bits (84), Expect = 0.014 Identities = 14/23 (60%), Positives = 19/23 (82%) Frame = +1 Query: 4 VLIRGEQLVSLNVDGPPPTEDSA 72 VL+RGE +VS+ VDGPPP +D + Sbjct: 70 VLVRGEHIVSMTVDGPPPRDDDS 92
>sp|P14678|RSMB_HUMAN Small nuclear ribonucleoprotein associated proteins B and B' (snRNP-B) (Sm protein B/B') (Sm-B/Sm-B') (SmB/SmB') Length = 240 Score = 33.1 bits (74), Expect = 0.20 Identities = 13/20 (65%), Positives = 17/20 (85%) Frame = +1 Query: 4 VLIRGEQLVSLNVDGPPPTE 63 VL+RGE LVS+ V+GPPP + Sbjct: 70 VLLRGENLVSMTVEGPPPKD 89
>sp|P27048|RSMB_MOUSE Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) Length = 231 Score = 33.1 bits (74), Expect = 0.20 Identities = 13/20 (65%), Positives = 17/20 (85%) Frame = +1 Query: 4 VLIRGEQLVSLNVDGPPPTE 63 VL+RGE LVS+ V+GPPP + Sbjct: 70 VLLRGENLVSMTVEGPPPKD 89
>sp|P63162|RSMN_HUMAN Small nuclear ribonucleoprotein associated protein N (snRNP-N) (Sm protein N) (Sm-N) (SmN) (Sm-D) (Tissue-specific splicing protein) sp|P63164|RSMN_RAT Small nuclear ribonucleoprotein associated protein N (snRNP-N) (Sm protein N) (Sm-N) (SmN) (Sm-D) sp|P63163|RSMN_MOUSE Small nuclear ribonucleoprotein associated protein N (snRNP-N) (Sm protein N) (Sm-N) (SmN) (Sm-D) (Tissue-specific splicing protein) Length = 240 Score = 33.1 bits (74), Expect = 0.20 Identities = 13/20 (65%), Positives = 17/20 (85%) Frame = +1 Query: 4 VLIRGEQLVSLNVDGPPPTE 63 VL+RGE LVS+ V+GPPP + Sbjct: 70 VLLRGENLVSMTVEGPPPKD 89
>sp|Q9PV94|RSMB_CHICK Small nuclear ribonucleoprotein associated protein B' (snRNP-B') (Sm protein B') (Sm-B') (SmB') (snRPB') Length = 240 Score = 33.1 bits (74), Expect = 0.20 Identities = 13/20 (65%), Positives = 17/20 (85%) Frame = +1 Query: 4 VLIRGEQLVSLNVDGPPPTE 63 VL+RGE LVS+ V+GPPP + Sbjct: 70 VLLRGENLVSMTVEGPPPKD 89
>sp|Q9TU66|RSMB_MONDO Small nuclear ribonucleoprotein associated protein B' (snRNP-B') (Sm protein B') (Sm-B') (SmB') (snRPB') Length = 240 Score = 33.1 bits (74), Expect = 0.20 Identities = 13/20 (65%), Positives = 17/20 (85%) Frame = +1 Query: 4 VLIRGEQLVSLNVDGPPPTE 63 VL+RGE LVS+ V+GPPP + Sbjct: 70 VLLRGENLVSMTVEGPPPKD 89
>sp|P40582|GST1_YEAST Glutathione S-transferase I (GST-I) Length = 234 Score = 33.1 bits (74), Expect = 0.20 Identities = 12/39 (30%), Positives = 25/39 (64%) Frame = -3 Query: 193 PMLEVQLNQEVVRRLLGKKAFLYQQLVQHLPHQYQVIQE 77 P+LEVQ + +++L + F++Q ++QH H + ++ E Sbjct: 57 PLLEVQDRETGKKKILAESGFIFQYVLQHFDHSHVLMSE 95
>sp|Q9TU67|RSMB_ERIEU Small nuclear ribonucleoprotein associated protein B' (snRNP-B') (Sm protein B') (Sm-B') (SmB') (snRPB') Length = 240 Score = 33.1 bits (74), Expect = 0.20 Identities = 13/20 (65%), Positives = 17/20 (85%) Frame = +1 Query: 4 VLIRGEQLVSLNVDGPPPTE 63 VL+RGE LVS+ V+GPPP + Sbjct: 70 VLLRGENLVSMTVEGPPPKD 89
>sp|P17136|RSMB_RAT Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) (SM11) Length = 214 Score = 33.1 bits (74), Expect = 0.20 Identities = 13/20 (65%), Positives = 17/20 (85%) Frame = +1 Query: 4 VLIRGEQLVSLNVDGPPPTE 63 VL+RGE LVS+ V+GPPP + Sbjct: 53 VLLRGENLVSMTVEGPPPKD 72
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,636,332 Number of Sequences: 369166 Number of extensions: 552316 Number of successful extensions: 1763 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1729 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1762 length of database: 68,354,980 effective HSP length: 92 effective length of database: 51,359,360 effective search space used: 1694858880 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)