Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_001_D16 (626 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P20828|GAG2_DROME Retrovirus-related Gag polyprotein fro... 31 3.0 sp|Q9GKY1|B3A4_RABIT Anion exchange protein 4 (Anion exchan... 29 8.6
>sp|P20828|GAG2_DROME Retrovirus-related Gag polyprotein from transposon 297 Length = 414 Score = 30.8 bits (68), Expect = 3.0 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = -3 Query: 201 NHPS-SRSARPPRANFTFTFSCIYLRPLRRRWNASIRRNPPCWRQQRWQRP 52 N PS S+ ++P + NF Y++P R + I NPP W + RP Sbjct: 227 NRPSYSQYSQPFQPNFNQ-----YIQPFRPSYTQQITNNPPMWHAPNYFRP 272
>sp|Q9GKY1|B3A4_RABIT Anion exchange protein 4 (Anion exchanger 4) (Solute carrier family 4 member 9) Length = 955 Score = 29.3 bits (64), Expect = 8.6 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = +1 Query: 61 PSLLPPTRRVPPDRCIPAAAEGAEVNT*KSKGKICTRRAGA 183 P PT R+PP RC+P+ + ++ K KG R A Sbjct: 296 PGRWDPTARIPPPRCLPSRHKRPPLHLQKVKGLSVPHRTQA 336
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,687,140 Number of Sequences: 369166 Number of extensions: 988005 Number of successful extensions: 2497 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2404 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2492 length of database: 68,354,980 effective HSP length: 106 effective length of database: 48,773,070 effective search space used: 4974853140 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)