Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_001_A06 (639 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q9VVN6|CP312_DROME Probable cytochrome P450 312a1 (CYPCC... 30 5.2 sp|P32949|LIP5_CANRU Lipase 5 precursor 30 6.8 sp|P16415|ZF36_HUMAN Zinc finger protein ZFP-36 30 6.8
>sp|Q9VVN6|CP312_DROME Probable cytochrome P450 312a1 (CYPCCCXIIA1) Length = 510 Score = 30.0 bits (66), Expect = 5.2 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = +1 Query: 79 VCGQDKSATSSLCKLYYSDYMEMGAFSTAKFIPDGPTLNIQYTAN 213 VCG+DKS S+ ++ +++E T + P GP + TAN Sbjct: 349 VCGKDKSEPISIEQVRQLEFLEACIKETLRMYPSGPLTARKATAN 393
>sp|P32949|LIP5_CANRU Lipase 5 precursor Length = 549 Score = 29.6 bits (65), Expect = 6.8 Identities = 24/108 (22%), Positives = 37/108 (34%), Gaps = 15/108 (13%) Frame = +1 Query: 64 PCSEMVCGQDKSATSSLCKLYYSD---------YMEMGAFSTAKFIPDGPTLNIQYTANR 216 P + G+ + S LC L ++ G + +P P T Sbjct: 215 PSKVTIFGESAGSMSVLCHLLWNGGDNTYKGKPLFRAGIMQSGAMVPSDPVDGTYGTQIY 274 Query: 217 DSAFTST------MKLVCNENIDAQVDYIREASDNPGYLEYLQLQSKY 342 D+ ST KL C + Q + +D PG+L Y L+ Y Sbjct: 275 DTLVASTGCSSASNKLACLRGLSTQA-LLDATNDTPGFLSYTSLRLSY 321
>sp|P16415|ZF36_HUMAN Zinc finger protein ZFP-36 Length = 582 Score = 29.6 bits (65), Expect = 6.8 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = -2 Query: 419 NIINSTSPTLNPFFVGFTGFIVRKHAYLDCNWR 321 +I+N +P +NP G G +V H+ L+CN R Sbjct: 120 SIVNKNTPRVNPCDSGECGEVVLGHSSLNCNIR 152
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 79,481,805 Number of Sequences: 369166 Number of extensions: 1592550 Number of successful extensions: 3869 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3745 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3869 length of database: 68,354,980 effective HSP length: 106 effective length of database: 48,773,070 effective search space used: 5169945420 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)